Signal Peptide Database - Bacteria

 Entry Details
ID   119
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P39041    (Created: 1995-02-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   CBPS_STRCP
Protein Name   Zinc carboxypeptidase
Gene  
Organism Scientific   Streptomyces capreolus
Organism Common  
Lineage   Bacteria
  Actinobacteria
    Actinobacteridae
      Actinomycetales
        Pseudonocardineae
          Actinosynnemataceae
            Saccharothrix
Protein Length [aa]   434
Protein Mass [Da]   48477
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   33
chain   Zinc carboxypeptidase      115   434
active site   Proton donor   by similarity   366   366
active site   Nucleophile   by similarity   388   388
propeptide   Activation peptide   potential   34   114
metal ion-binding site   Zinc   by similarity   183   183
metal ion-binding site   Zinc   by similarity   186   186
metal ion-binding site   Zinc   by similarity   315   315
SP Length   33
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MSPKRRRLMAAALGACVALVLPLHAGSAQPSTA
Sequence MSPKRRRLMAAALGACVALVLPLHAGSAQPSTAKTPERTVFEVTASTPEA
RTRVARTGVDVLGQDGDKLTVVAEPRQQWALRATGLRVENLGDYDAQLQA
LGKVDFTDPQVGTQ
DFPSGYTGYHNFQETVTELNQTVTDHPNLVRLSSVG
KSYQGRDLWMLKLSDNPAVDENEPEVLFTCNM
HAREHLTVEMCLRIIKQY
TDGYATNPTIKNLVDSREIWIIPMVNPDGVEYDIATGSFRSWRKNRQPNS
TAVGTDPNRNWGYQWGCCGGSSSSGSSETTAARRRSPPRRSPHPHFVNTR
VVGGVQQIKTHIDW
HTYSELILWPYGYTYNDTAPGLDAQQASAFSTLGRR
MASLNGTRRQQSSDL
YITDGTINDWLWGVHKIWSYTFEMYPKSSSPGFYP
RDTVIATQTQRNDSAVELFLSYSDCVPRIIGRTC
Original MSPKRRRLMAAALGACVALVLPLHAGSAQPSTAKTPERTVFEVTASTPEA
RTRVARTGVDVLGQDGDKLTVVAEPRQQWALRATGLRVENLGDYDAQLQA
LGKVDFTDPQVGTQDFPSGYTGYHNFQETVTELNQTVTDHPNLVRLSSVG
KSYQGRDLWMLKLSDNPAVDENEPEVLFTCNMHAREHLTVEMCLRIIKQY
TDGYATNPTIKNLVDSREIWIIPMVNPDGVEYDIATGSFRSWRKNRQPNS
TAVGTDPNRNWGYQWGCCGGSSSSGSSETTAARRRSPPRRSPHPHFVNTR
VVGGVQQIKTHIDWHTYSELILWPYGYTYNDTAPGLDAQQASAFSTLGRR
MASLNGTRRQQSSDLYITDGTINDWLWGVHKIWSYTFEMYPKSSSPGFYP
RDTVIATQTQRNDSAVELFLSYSDCVPRIIGRTC
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11