Signal Peptide Database - Bacteria

 Entry Details
ID   146
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q99SU8    (Created: 2008-02-26 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   CHIPS_STAAN
Protein Name   Chemotaxis inhibitory protein
Gene   chp
Organism Scientific   Staphylococcus aureus (strain N315)
Organism Common  
Lineage   Bacteria
  Firmicutes
    Bacillales
      Staphylococcus
Protein Length [aa]   149
Protein Mass [Da]   17073
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   28
chain   Chemotaxis inhibitory protein      29   149
region of interest   FPR-blocking activity   by similarity   29   34
region of interest   C5aR-blocking activity   by similarity   59   149
SP Length   28
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKKKLATTVLALSFLTAGISTHHHSAKA
Sequence MKKKLATTVLALSFLTAGISTHHHSAKAFTFEPFPTNEEIESNKKMLEKE
KAYKESFK
NSGLPTTLGKLDERLRNYLEKGTKNTAQFEKMVILTENKGYY
TVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY
Original MKKKLATTVLALSFLTAGISTHHHSAKAFTFEPFPTNEEIESNKKMLEKE
KAYKESFKNSGLPTTLGKLDERLRNYLEKGTKNTAQFEKMVILTENKGYY
TVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11