Signal Peptide Database - Bacteria

 Entry Details
ID   152
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q6G644    (Created: 2005-09-27 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   CLFB_STAAS
Protein Name   Clumping factor B
Gene   clfB
Organism Scientific   Staphylococcus aureus (strain MSSA476)
Organism Common  
Lineage   Bacteria
  Firmicutes
    Bacillales
      Staphylococcus
Protein Length [aa]   905
Protein Mass [Da]   96412
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   44
chain   Clumping factor B      45   869
region of interest   Ligand binding A region   by similarity   45   542
modified residue   Pentaglycyl murein peptidoglycan amidated threonine   potential   869   869
site   Cleavage; by aureolysin   by similarity   197   198
site   Cleavage; by aureolysin   by similarity   199   200
propeptide   Removed by sortase   potential   870   905
compositionally biased region   Pro-rich      543   584
compositionally biased region   Asp/Ser-rich      567   831
short sequence motif   MIDAS-like motif      272   276
short sequence motif   LPXTG sorting signal   potential   866   870
SP Length   44
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKKRIDYLSNKQNKYSIRRFTVGTTSVIVGATILFGIGNHQAQA
Sequence MKKRIDYLSNKQNKYSIRRFTVGTTSVIVGATILFGIGNHQAQASEQSND
TTQSSKNNASADSEKNNMIETPQLNTTANDTSDISANTNSANVDSTAKPM
STQTSNTTTTEPASTNETPQLTAIKDQATAAKMQDQTVPQEANSQVDNKT
TNDANSIATNSELKNPQTLDLPQSSPQTISNAQGTSKPSVRTRAVR
SLAV
AEPVVNAADAKGTNVNDKVTAKDFQLEKTTFDPNQSGNTFMAANFTVTGQ
VKSGDYFTAKLPDSVTGNGDV
DYSNSNNTMPIADIVNDKNEVVAKATYDI
LTKTYTFVFTDYVNDKQNINGKFSLPLFTDRAKAPKSGTYDANINIADEM
FNNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQ
RVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSDSYYADP
NDSNLKEVTDQFKDKITYKYQNVASINFGDINKTYVVLVEGHYDKTGKNL
KTQVIQENVDPATGKDYSIFGWNNENVVRYGGGSADGDSAVN
PKDPTPGP
PVDPEPSPDPEPEPSP
DPDPEPTPDPEPSPDPDPDSDSDSDSGSDSDSDS
DSDSDSDSDSGSDSDSDSDSDSESDSESDSDSDSESDSDSDSDSESDSDS
DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSESDSDSDS
DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDS
DSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
ESDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
SRVTPPNNEQKAPSNPKGE
VNHSNKVSKQHKTDA
LPETGDKSENTNATLFGAMMALLGSLLLFRKRKQD
HKEKA
Original MKKRIDYLSNKQNKYSIRRFTVGTTSVIVGATILFGIGNHQAQASEQSND
TTQSSKNNASADSEKNNMIETPQLNTTANDTSDISANTNSANVDSTAKPM
STQTSNTTTTEPASTNETPQLTAIKDQATAAKMQDQTVPQEANSQVDNKT
TNDANSIATNSELKNPQTLDLPQSSPQTISNAQGTSKPSVRTRAVRSLAV
AEPVVNAADAKGTNVNDKVTAKDFQLEKTTFDPNQSGNTFMAANFTVTGQ
VKSGDYFTAKLPDSVTGNGDVDYSNSNNTMPIADIVNDKNEVVAKATYDI
LTKTYTFVFTDYVNDKQNINGKFSLPLFTDRAKAPKSGTYDANINIADEM
FNNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQ
RVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSDSYYADP
NDSNLKEVTDQFKDKITYKYQNVASINFGDINKTYVVLVEGHYDKTGKNL
KTQVIQENVDPATGKDYSIFGWNNENVVRYGGGSADGDSAVNPKDPTPGP
PVDPEPSPDPEPEPSPDPDPEPTPDPEPSPDPDPDSDSDSDSGSDSDSDS
DSDSDSDSDSGSDSDSDSDSDSESDSESDSDSDSESDSDSDSDSESDSDS
DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSESDSDSDS
DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDS
DSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
ESDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSRVTPPNNEQKAPSNPKGE
VNHSNKVSKQHKTDALPETGDKSENTNATLFGAMMALLGSLLLFRKRKQD
HKEKA
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11