Signal Peptide Database - Bacteria

 Entry Details
ID   166
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9JVB7    (Created: 2001-09-26 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   COML_NEIMA
Protein Name   Competence lipoprotein comL
Gene   comL
Organism Scientific   Neisseria meningitidis serogroup A
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Betaproteobacteria
      Neisseriales
        Neisseriaceae
          Neisseria
Protein Length [aa]   267
Protein Mass [Da]   30809
Features  
TypeDescriptionStatusStartEnd
signal peptide      probable   1   16
chain   Competence lipoprotein comL      17   267
lipid moiety-binding region   N-palmitoyl cysteine   probable   17   17
lipid moiety-binding region   S-diacylglycerol cysteine   probable   17   17
SP Length   16
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKKILLTVSLGLALSA
Sequence MKKILLTVSLGLALSACATQGTVDKDAQITQDWSVEKLYAEAQDELNSSN
YTRAVKLYEILESRFPTSRHARQSQLDTAYAYYKDDEKDKALAAIERFRR
LHPQHPNMDYALYLRGLVLFNEDQSFLNKLASQDWSDRDPKANREAYQAF
AELVQRFPNSKYAADATARMVKLVDALGGNEMSVARYYMKRGAYIAAANR
AQKIIGSYQNTRYVEESLAILELAYQKLGKPQLAADTRRVLETNFPKSPF
LTHAWQPDDMPWWRYWH
Original MKKILLTVSLGLALSACATQGTVDKDAQITQDWSVEKLYAEAQDELNSSN
YTRAVKLYEILESRFPTSRHARQSQLDTAYAYYKDDEKDKALAAIERFRR
LHPQHPNMDYALYLRGLVLFNEDQSFLNKLASQDWSDRDPKANREAYQAF
AELVQRFPNSKYAADATARMVKLVDALGGNEMSVARYYMKRGAYIAAANR
AQKIIGSYQNTRYVEESLAILELAYQKLGKPQLAADTRRVLETNFPKSPF
LTHAWQPDDMPWWRYWH
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11