Signal Peptide Database - Bacteria

 Entry Details
ID   2
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   A6X5T5    (Created: 2009-01-20 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   14KL_OCHA4
Protein Name   Lectin-like protein BA14k
Gene   Oant_3884
Organism Scientific   Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168)
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Alphaproteobacteria
      Rhizobiales
        Brucellaceae
          Ochrobactrum
Protein Length [aa]   151
Protein Mass [Da]   17666
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   26
chain   Lectin-like protein BA14k      27   151
transmembrane region      potential   83   103
SP Length   26
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MNIFKQTCVGAFAVIFGATSIAPTMA
Sequence MNIFKQTCVGAFAVIFGATSIAPTMAAPLNLERPVINHNVEQVRDHRRPP
RHYNGHRPHRPGYWNGHRGYRHYRHGYRRYND
GWWYPLAAFGAGAIIGGA
VSQ
PRPVYRAPRMSNAHVQWCYNRYKSYRSSDNTFQPYNGPRRQCYSPYS
R
Original MNIFKQTCVGAFAVIFGATSIAPTMAAPLNLERPVINHNVEQVRDHRRPP
RHYNGHRPHRPGYWNGHRGYRHYRHGYRRYNDGWWYPLAAFGAGAIIGGA
VSQPRPVYRAPRMSNAHVQWCYNRYKSYRSSDNTFQPYNGPRRQCYSPYS
R
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11