Signal Peptide Database - Bacteria

 Entry Details
ID   206
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q8Z0D7    (Created: 2003-01-10 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   CYC6L_ANASP
Protein Name   Cytochrome c6-like
Gene   all0161
Organism Scientific   Anabaena sp. (strain PCC 7120)
Organism Common  
Lineage   Bacteria
  Cyanobacteria
    Nostocales
      Nostocaceae
        Nostoc
Protein Length [aa]   111
Protein Mass [Da]   12457
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   25
chain   Cytochrome c6-like      26   111
metal ion-binding site   Iron (heme axial ligand)   by similarity   43   43
metal ion-binding site   Iron (heme axial ligand)   by similarity   83   83
binding site   Heme (covalent)   by similarity   39   39
binding site   Heme (covalent)   by similarity   42   42
SP Length   25
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MQKFLKLVLVTFLFLISTLTPPANA
Sequence MQKFLKLVLVTFLFLISTLTPPANAENTINGEQIFSVHCAGCHINGSNII
RRGKNLQKKTLKKYGMDSLEAIEAIVTNGKNN
MSAYKDRLSEQEIQDVAA
YVLEQAEKGWR
Original MQKFLKLVLVTFLFLISTLTPPANAENTINGEQIFSVHCAGCHINGSNII
RRGKNLQKKTLKKYGMDSLEAIEAIVTNGKNNMSAYKDRLSEQEIQDVAA
YVLEQAEKGWR
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11