Signal Peptide Database - Bacteria

 Entry Details
ID   207
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P81040    (Created: 1997-11-01 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   CYCX_DESDE
Protein Name   Split-Soret cytochrome c
Gene  
Organism Scientific   Desulfovibrio desulfuricans
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Deltaproteobacteria
      Desulfovibrionales
        Desulfovibrionaceae
          Desulfovibrio
Protein Length [aa]   279
Protein Mass [Da]   29989
Features  
TypeDescriptionStatusStartEnd
signal peptide   Tat-type signal      1   32
chain   Split-Soret cytochrome c      33   279
modified residue   Blocked amino end (Gly)      33   33
strand         243   245
helix         26   38
helix         39   41
helix         44   60
helix         64   66
helix         69   78
helix         87   99
helix         102   118
helix         127   129
helix         147   158
helix         165   192
helix         193   195
helix         204   213
metal ion-binding site   Iron-sulfur (2Fe-2S)   probable   76   76
metal ion-binding site   Iron-sulfur (2Fe-2S)   probable   118   118
metal ion-binding site   Iron-sulfur (2Fe-2S)   probable   179   179
metal ion-binding site   Iron (heme 2 axial ligand); in dimeric partner      180   180
metal ion-binding site   Iron-sulfur (2Fe-2S)   probable   203   203
metal ion-binding site   Iron (heme 1 axial ligand)      245   245
metal ion-binding site   Iron (heme 2 axial ligand)      265   265
metal ion-binding site   Iron (heme 1 axial ligand); in dimeric partner      278   278
binding site   Heme 1 (covalent)      241   241
binding site   Heme 1 (covalent)      244   244
binding site   Heme 2 (covalent)      261   261
binding site   Heme 2 (covalent)      264   264
turn         79   81
turn         230   232
SP Length   32
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MNIGRRDLICGLGGLAVGGAMLGLGSVEARAA
Sequence MNIGRRDLICGLGGLAVGGAMLGLGSVEARAAGQAQPASGRFDQVGGAFG
WKPHKLDPKE
CAQVAYDGYWYKGFGCGFGAFYSIVGLMGEKYGAPYNQFP
F
AMLEANKGGISDWGTICGALYGAAATFSLFWGRKEVHPMVNELFRWYEV
TKLPIFNP
GDAAQGVKGDLPMSASDSVLCHISVSKWCYENKIEATSKQRS
ER
CGRLTADAAFKAAEIINTKIDQGKDFKSTFPMQASVSSCGECHMTKGN
DANWAKGIMD
CTPCHSGTAATQNKFVNHP
Original MNIGRRDLICGLGGLAVGGAMLGLGSVEARAAGQAQPASGRFDQVGGAFG
WKPHKLDPKECAQVAYDGYWYKGFGCGFGAFYSIVGLMGEKYGAPYNQFP
FAMLEANKGGISDWGTICGALYGAAATFSLFWGRKEVHPMVNELFRWYEV
TKLPIFNPGDAAQGVKGDLPMSASDSVLCHISVSKWCYENKIEATSKQRS
ERCGRLTADAAFKAAEIINTKIDQGKDFKSTFPMQASVSSCGECHMTKGN
DANWAKGIMDCTPCHSGTAATQNKFVNHP
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11