Signal Peptide Database - Bacteria

 Entry Details
ID   213
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q8KAS5    (Created: 2002-11-25 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   CYSD_CHLTE
Protein Name   Cytochrome subunit of sulfide dehydrogenase
Gene   fccA
Organism Scientific   Chlorobium tepidum
Organism Common  
Lineage   Bacteria
  Chlorobi
    Chlorobia
      Chlorobiales
        Chlorobiaceae
          Chlorobaculum
Protein Length [aa]   110
Protein Mass [Da]   11438
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   16
chain   Cytochrome subunit of sulfide dehydrogenase      17   110
metal ion-binding site   Iron (heme axial ligand)   by similarity   45   45
metal ion-binding site   Iron (heme axial ligand)   by similarity   83   83
binding site   Heme (covalent)   by similarity   41   41
binding site   Heme (covalent)   by similarity   44   44
SP Length   16
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLAAAPLLLASGNGFA
Sequence MLAAAPLLLASGNGFATTGPAAKPAVKPVTESRGEILSLSCAGCHGTDGN
SSSVIPSIYGKSPEYIETALIDFKNGSRTSTV
MGRHAKGYTGEEIHLIAE
YFGNLSKKNH
Original MLAAAPLLLASGNGFATTGPAAKPAVKPVTESRGEILSLSCAGCHGTDGN
SSSVIPSIYGKSPEYIETALIDFKNGSRTSTVMGRHAKGYTGEEIHLIAE
YFGNLSKKNH
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11