Signal Peptide Database - Bacteria

 Entry Details
ID   228
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P05465    (Created: 1988-11-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   DHGA_ACICA
Protein Name   Quinoprotein glucose dehydrogenase A
Gene   gdhA
Organism Scientific   Acinetobacter calcoaceticus
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Pseudomonadales
        Moraxellaceae
          Acinetobacter
Protein Length [aa]   801
Protein Mass [Da]   86957
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   33
chain   Quinoprotein glucose dehydrogenase A      34   801
transmembrane region      potential   39   55
transmembrane region      potential   59   79
transmembrane region      potential   94   108
transmembrane region      potential   119   138
active site   Proton acceptor   potential   471   471
SP Length   33
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MNQPTSRSGLTTFTVIIIGLLALFLLIGGIWLA
Sequence MNQPTSRSGLTTFTVIIIGLLALFLLIGGIWLATLGGSIYYIIAGVLLLI
VAWQL
YKRASTALWFYAALMLGTIIWSVWEVGTDFWALAPRLDILGILGL
WLLVPAVT
RGINNLGSSKVALSSTLAIAIVLMVYSIFNDPQEINGEIKTP
QPETAQAVPGVAESDWPAYGRTQAGVRYSPLKQINDQNVKDLKVAWTLRT
GDLKTDNDSGETTNQVTPIKIGNNMFICTAHQQLIAIDPATGKEKWRFDP
KLKTDKSFQHLTCRGVMYYDANNTTEFATSLQSKKSSSTQCPRKVFVPVN
DGRLVAVNADTGKACTDFGQNGQVNLQEFMPYAYPGGYNPTSPGIVTGST
VVIAGSVTDNYSNKEPSGVIRGYDVNTGKLLWVFDTGAADPNAMPGEGTT
FVHNSPNAWAPLAYDAKLDIVYVPTGVGTPDIWGGDRTELKERYANSMLA
INASTGKLVWNFQTTHHDLW
DMDVPSQPSLADIKNKAGQTVPAIYVLTKT
GNAFVLDRRNGQPIVPVTEKPVPQTVKRGPQTKGEFYSKTQPFSDLNLAP
QDKLTDKDMWGATMLDQLMCRVSFKRLNYDGIYTPPSENGTLVFPGNLGV
FEWGGMSVNPDRQVAVMNPIGLPFVSRLIPADPNRAQTAKGAGTEQGVQP
MYGVPYGVEISAFLSPLGLPCKQPAWGYVAGVDLKTHEVVWKKRIGTIRD
SLPNLFQLPAVKIGVPGLGGSISTAGNVMFVGATQDNYLRAFNVTNGKKL
WEARLPAGGQATPMTYEINGKQYVVIMAGGHGSFGTKMGDYLVAYALPDN
K
Original MNQPTSRSGLTTFTVIIIGLLALFLLIGGIWLATLGGSIYYIIAGVLLLI
VAWQLYKRASTALWFYAALMLGTIIWSVWEVGTDFWALAPRLDILGILGL
WLLVPAVTRGINNLGSSKVALSSTLAIAIVLMVYSIFNDPQEINGEIKTP
QPETAQAVPGVAESDWPAYGRTQAGVRYSPLKQINDQNVKDLKVAWTLRT
GDLKTDNDSGETTNQVTPIKIGNNMFICTAHQQLIAIDPATGKEKWRFDP
KLKTDKSFQHLTCRGVMYYDANNTTEFATSLQSKKSSSTQCPRKVFVPVN
DGRLVAVNADTGKACTDFGQNGQVNLQEFMPYAYPGGYNPTSPGIVTGST
VVIAGSVTDNYSNKEPSGVIRGYDVNTGKLLWVFDTGAADPNAMPGEGTT
FVHNSPNAWAPLAYDAKLDIVYVPTGVGTPDIWGGDRTELKERYANSMLA
INASTGKLVWNFQTTHHDLWDMDVPSQPSLADIKNKAGQTVPAIYVLTKT
GNAFVLDRRNGQPIVPVTEKPVPQTVKRGPQTKGEFYSKTQPFSDLNLAP
QDKLTDKDMWGATMLDQLMCRVSFKRLNYDGIYTPPSENGTLVFPGNLGV
FEWGGMSVNPDRQVAVMNPIGLPFVSRLIPADPNRAQTAKGAGTEQGVQP
MYGVPYGVEISAFLSPLGLPCKQPAWGYVAGVDLKTHEVVWKKRIGTIRD
SLPNLFQLPAVKIGVPGLGGSISTAGNVMFVGATQDNYLRAFNVTNGKKL
WEARLPAGGQATPMTYEINGKQYVVIMAGGHGSFGTKMGDYLVAYALPDN
K
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11