Signal Peptide Database - Bacteria

 Entry Details
ID   240
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P24093    (Created: 1992-03-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   DRAA_ECOLX
Protein Name   Dr hemagglutinin structural subunit
Gene   draA
Organism Scientific   Escherichia coli
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Enterobacteriales
        Enterobacteriaceae
          Escherichia
Protein Length [aa]   160
Protein Mass [Da]   17058
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   21
chain   Dr hemagglutinin structural subunit      22   160
region of interest   Receptor-binding   potential   22   75
sequence variant   (in strain: 950, 5026)      0   0
strand         22   37
strand         39   46
strand         50   52
strand         61   71
strand         75   81
strand         90   95
strand         101   111
strand         114   117
strand         120   125
strand         130   137
strand         146   159
helix         53   55
helix         83   85
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKKLAIMAAASMVFAVSSAHA
Sequence MKKLAIMAAASMVFAVSSAHAGFTPSGTTGTTKLTVTEECQVRVGDLTVA
KT
RGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRD
KLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYT
LTLTGGYWA
K
Original MKKLAIMAAASMVFAVSSAHAGFTPSGTTGTTKLTVTEECQVRVGDLTVA
KTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRD
KLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYT
LTLTGGYWAK
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11