Signal Peptide Database - Bacteria

 Entry Details
ID   241
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q7W2Q0    (Created: 2006-07-11 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   DSBA_BORPA
Protein Name   Thiol:disulfide interchange protein dsbA
Gene   dsbA
Organism Scientific   Bordetella parapertussis
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Betaproteobacteria
      Burkholderiales
        Alcaligenaceae
          Bordetella
Protein Length [aa]   209
Protein Mass [Da]   22817
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   27
chain   Thiol:disulfide interchange protein dsbA      28   209
disulfide bond   Redox-active   by similarity   58   61
domain   Thioredoxin      28   166
SP Length   27
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MQSTTFTRLLAAAALAATTLFAPATQA
Sequence MQSTTFTRLLAAAALAATTLFAPATQAQGAQQYVNINPPMPSDTPGKIEV
LEFFAYTCPHCAAIEPMVEDWAKTAPQDVVLKQVPIAFNAGMKPLQQLYY
TLQALERPDLHPKVFTAIHTERKRLFDKKAMGEWAASQGVDRAKFDSVFD
SFSVQTQVQRASQLAE
AAHIDGTPAFAVGGRYMTSPVLAGNDYAGALKVV
DQLIVQSRK
Original MQSTTFTRLLAAAALAATTLFAPATQAQGAQQYVNINPPMPSDTPGKIEV
LEFFAYTCPHCAAIEPMVEDWAKTAPQDVVLKQVPIAFNAGMKPLQQLYY
TLQALERPDLHPKVFTAIHTERKRLFDKKAMGEWAASQGVDRAKFDSVFD
SFSVQTQVQRASQLAEAAHIDGTPAFAVGGRYMTSPVLAGNDYAGALKVV
DQLIVQSRK
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11