Signal Peptide Database - Bacteria

 Entry Details
ID   242
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q7VMZ4    (Created: 2005-07-19 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   DSBD_HAEDU
Protein Name   Thiol:disulfide interchange protein dsbD
Gene   dsbD
Organism Scientific   Haemophilus ducreyi
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Pasteurellales
        Pasteurellaceae
          Haemophilus
Protein Length [aa]   573
Protein Mass [Da]   63070
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   20
chain   Thiol:disulfide interchange protein dsbD      21   573
disulfide bond   Redox-active   by similarity   121   126
disulfide bond   Redox-active   by similarity   191   313
disulfide bond   Redox-active   by similarity   490   493
transmembrane region      potential   176   196
transmembrane region      potential   228   248
transmembrane region      potential   252   272
transmembrane region      potential   293   313
transmembrane region      potential   332   352
transmembrane region      potential   366   386
transmembrane region      potential   394   414
transmembrane region      potential   426   446
topological domain   Periplasmic   potential   21   175
topological domain   Cytoplasmic   potential   197   227
topological domain   Periplasmic   potential   249   251
topological domain   Cytoplasmic   potential   273   292
topological domain   Periplasmic   potential   314   331
topological domain   Cytoplasmic   potential   353   365
topological domain   Periplasmic   potential   387   393
topological domain   Cytoplasmic   potential   415   425
topological domain   Periplasmic   potential   447   573
domain   Thioredoxin      440   573
SP Length   20
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLKRFFLLLSSLLLVCNVQA
Sequence MLKRFFLLLSSLLLVCNVQAGLFNNKPQYLTAAEAFIFSSSQQDGQLQLH
WQIADGYYLYQKEIQLSAQNATLGDVTFPTAEKYQDEFFGEVAIFRDQLK
LPVKLTDLKENPSLKIRYQGCTKGFCYPPETVVIPLNPSLQGNNSANSAA
LPSTIATPNAPQTELAENLSNNYLS
IFGFLLLGIGLAFTPCVLPMLPLLS
AIVIGHKNRPNTSRALLLSFTYVQGMA
LTYTLLGLTVAAIGLPFQVALQS
P
AVLISLAVLFTLLAASMFGLFEIRLPNTWQQKLNALSQQQQGGAVGNVF
IMGIIAGLVASPC
TSAPLSGALLYVAQSGNLLIGGLALYLLALGMGLPLI
LI
TVFGNQILPKSGEWLFKVKTAFGFVMLALPIFLISRILPSHYEPFLWS
TLALAFLGWLISSL
NYSTMLKQAVRILLFIAFGLTAYPWANLVWQTTSNT
AQPTTPHLAMEKITSLTELEQKLTAYQGKKVMLDLYADWCVACKEFEKYT
FTDPQVQQQLATMAVLQIDMTKNSAENTALMKHFNVLGLPTILFFDENGH
EMTNVRITGFLTANQFLAWLNRL
Original MLKRFFLLLSSLLLVCNVQAGLFNNKPQYLTAAEAFIFSSSQQDGQLQLH
WQIADGYYLYQKEIQLSAQNATLGDVTFPTAEKYQDEFFGEVAIFRDQLK
LPVKLTDLKENPSLKIRYQGCTKGFCYPPETVVIPLNPSLQGNNSANSAA
LPSTIATPNAPQTELAENLSNNYLSIFGFLLLGIGLAFTPCVLPMLPLLS
AIVIGHKNRPNTSRALLLSFTYVQGMALTYTLLGLTVAAIGLPFQVALQS
PAVLISLAVLFTLLAASMFGLFEIRLPNTWQQKLNALSQQQQGGAVGNVF
IMGIIAGLVASPCTSAPLSGALLYVAQSGNLLIGGLALYLLALGMGLPLI
LITVFGNQILPKSGEWLFKVKTAFGFVMLALPIFLISRILPSHYEPFLWS
TLALAFLGWLISSLNYSTMLKQAVRILLFIAFGLTAYPWANLVWQTTSNT
AQPTTPHLAMEKITSLTELEQKLTAYQGKKVMLDLYADWCVACKEFEKYT
FTDPQVQQQLATMAVLQIDMTKNSAENTALMKHFNVLGLPTILFFDENGH
EMTNVRITGFLTANQFLAWLNRL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11