Signal Peptide Database - Bacteria

 Entry Details
ID   243
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q1C0X4    (Created: 2007-09-11 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   DSBD_YERPA
Protein Name   Thiol:disulfide interchange protein dsbD
Gene   dsbD
Organism Scientific   Yersinia pestis bv. Antiqua (strain Antiqua)
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Enterobacteriales
        Enterobacteriaceae
          Yersinia
Protein Length [aa]   595
Protein Mass [Da]   64506
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   24
chain   Thiol:disulfide interchange protein dsbD      25   595
disulfide bond   Redox-active   by similarity   134   140
disulfide bond   Redox-active   by similarity   209   331
disulfide bond   Redox-active   by similarity   507   510
transmembrane region      potential   197   217
transmembrane region      potential   233   253
transmembrane region      potential   270   290
transmembrane region      potential   311   331
transmembrane region      potential   332   352
transmembrane region      potential   353   373
transmembrane region      potential   384   404
transmembrane region      potential   411   431
transmembrane region      potential   435   455
domain   Thioredoxin      452   592
SP Length   24
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MAQRFITLILLLCSVLLAPHSAQS
Sequence MAQRFITLILLLCSVLLAPHSAQSSLFGENASFGTKNSQSRFIPVDQAFA
FDFHQQGDQLNLSWQIHPGYYLYRQQIKIVPQQAALGAFTLPEGITHHDE
FYGEVEIFKQQLTLKIPITQAAEQASVSVTYQG
CAEAGFCYPPETRVIPL
DVVVAASTASGTAAVNSSATVNPPATTQPEGDATPVPSTLPFSPLW
ALLI
GIGIAFTPCVLPMYPLI
SAVILGREKPHSQRRILILAVVYVQGMALTYTL
LGL
VVAAAGLQFQAALQHPYVLIGLSVLFVLLALSMFGLYSLQLPSSLQT
RLTQWSNSQR
GGSLAGVFAMGALAGLICSPCTTAPLSAILLYIAQSGNML
AG
GGTLYLYALGMGIPLVVVTLFGNKLIPRSGPWMQYVKEAFGFVILALP
VFLL
ERVLGDVWGLRLWSLLAVAFFGWAFVLSLKAHAGWVRVCQLLLLAA
L
LIVARPLQDWAFNGNTQQNAVKHINFQPVANLPQLQAVLAQAQGKPVML
DLYADWCVACKEFEKYTFSDDKVQRQLANTLLLQADVTANNAEHATLLKK
FNVLGLPTILFFDSQGNEITAARVTGFMDAAQFLQHLQNTPA
VTK
Original MAQRFITLILLLCSVLLAPHSAQSSLFGENASFGTKNSQSRFIPVDQAFA
FDFHQQGDQLNLSWQIHPGYYLYRQQIKIVPQQAALGAFTLPEGITHHDE
FYGEVEIFKQQLTLKIPITQAAEQASVSVTYQGCAEAGFCYPPETRVIPL
DVVVAASTASGTAAVNSSATVNPPATTQPEGDATPVPSTLPFSPLWALLI
GIGIAFTPCVLPMYPLISAVILGREKPHSQRRILILAVVYVQGMALTYTL
LGLVVAAAGLQFQAALQHPYVLIGLSVLFVLLALSMFGLYSLQLPSSLQT
RLTQWSNSQRGGSLAGVFAMGALAGLICSPCTTAPLSAILLYIAQSGNML
AGGGTLYLYALGMGIPLVVVTLFGNKLIPRSGPWMQYVKEAFGFVILALP
VFLLERVLGDVWGLRLWSLLAVAFFGWAFVLSLKAHAGWVRVCQLLLLAA
LLIVARPLQDWAFNGNTQQNAVKHINFQPVANLPQLQAVLAQAQGKPVML
DLYADWCVACKEFEKYTFSDDKVQRQLANTLLLQADVTANNAEHATLLKK
FNVLGLPTILFFDSQGNEITAARVTGFMDAAQFLQHLQNTPAVTK
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11