Signal Peptide Database - Bacteria

 Entry Details
ID   251
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   A6QGY5    (Created: 2008-09-02 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   EBHB_STAAE
Protein Name   Extracellular matrix-binding protein ebhB
Gene   ebhB
Organism Scientific   Staphylococcus aureus (strain Newman)
Organism Common  
Lineage   Bacteria
  Firmicutes
    Bacillales
      Staphylococcus
Protein Length [aa]   7031
Protein Mass [Da]   752580
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   39
chain   Extracellular matrix-binding protein ebhB      40   7031
domain   FIVAR 1      2524   2580
domain   FIVAR 2      2610   2666
domain   FIVAR 3      2687   2750
domain   FIVAR 4      2780   2836
domain   FIVAR 5      2864   2919
domain   FIVAR 6      2947   3002
domain   FIVAR 7      3030   3085
domain   FIVAR 8      3154   3212
domain   FIVAR 9      3280   3339
domain   FIVAR 10      3407   3465
domain   FIVAR 11      3533   3591
domain   FIVAR 12      3659   3717
domain   FIVAR 13      3785   3843
domain   FIVAR 14      3911   3969
domain   FIVAR 15      4037   4095
domain   FIVAR 16      4163   4221
domain   FIVAR 17      4289   4347
domain   FIVAR 18      4415   4473
domain   FIVAR 19      4541   4599
domain   FIVAR 20      4667   4725
domain   FIVAR 21      4793   4851
domain   FIVAR 22      4919   4977
domain   FIVAR 23      5045   5103
domain   FIVAR 24      5171   5229
domain   FIVAR 25      5297   5355
domain   FIVAR 26      5423   5481
domain   FIVAR 27      5549   5607
domain   FIVAR 28      5675   5733
domain   FIVAR 29      5801   5859
domain   FIVAR 30      5927   5985
domain   FIVAR 31      6053   6111
domain   FIVAR 32      6179   6236
domain   FIVAR 33      6304   6362
domain   FIVAR 34      6430   6488
domain   FIVAR 35      6556   6614
domain   FIVAR 36      6682   6740
domain   FIVAR 37      6818   6866
domain   FIVAR 38      6934   6992
compositionally biased region   Thr-rich      1507   1670
SP Length   39
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MNYRDKIQKFSIRKYTVGTFSTVIATLVFLGFNTSQAHA
Sequence MNYRDKIQKFSIRKYTVGTFSTVIATLVFLGFNTSQAHAAETNQPASVVK
QKQQSNNEQTENRESQVQNSQNSQNGQSLSATHENEQPNISQANLVDQKV
AQSSTTNDEQPASQNVNTKKDSATAATTQPDKEQSKHKQNESQSANKNGN
DNRAAHVENHEANVVTASDSSDNGNVQHDRNELQAFFDANYHDYRFIDRE
NADSGTFNYVKGIFDKINTLLGSNDPINNKDLQLAYKELEQAVALIRTMP
QRQQTSRRSNRIQTRSVESRAAEPRSVSDYQNANSSYYVENANDGSGYPV
GTYINASSKGAPYNLPTTPWNTLKASDSKEIALMTAKQTGDGYQWVIKFN
KGHAPHQNMIFWFALPADQVPVGRTDFVTVNSDGTNVQWSHGAGAGANKP
LQQMWEYGVNDPHRSHDFKIRNRSGQVIYDWPTVHIYSLEDLSRASDYFS
EAGATPATKAFGRQNFEYINGQKPAESPGVPKVYTFIGQGDASYTISFKT
QGPTVNKLYYAAGGRALEYNQLFMYSQLYVESTQDHQQRLNGLRQVVNRT
YRIGTTKRVEVSQGNVQTKKVLESTNLNIDDFVDDPLSYVKTPSNKVLGF
YSNNANTNAFRPGGAQQLNEYQLSQLFTDQKLQEAARTRNPIRLMIGFDY
PDAYGNSETLVPVNLTVLPEIQHNIKFFKNDDTQNIAEKPFSKQAGHPVF
YVYAGNQGNASVNLGGSVTSIQPLRINLTSNENFTDKDWQITGIPRTLHI
ENSTNRPNNARERNIELVGNLLPGDYFGTIRFGRKEQLFEIRVKPHTPTI
TTTAEQLRGTALQKVPVNISGIPLDPSALVYLVAPTNQTTNGGSEADQIP
SGYTILATGTPDGVHNTITIRPQDYVVFIPPVGKQIRAVVYYNKVVASNM
SNAVTILPDDIPPTINNPVGINAKYYRGDEVNFTMGVSDRHSGIKNTTIT
TLPNGWTSNLTKADKNNGSLSITGRVSMNQAFNSDITFKVSATDNVNNTT
NDSQSKHVSIHVGKISEDAHPIVLGNTEKVVVVNPTAVSNDEKQSIITAF
MNKNQNIRGYLASTDPVTVDNNGNVTLHYRDGSSTTLDATNVMTYEPVVK
PEYQTVNAAKTATVTIAKGQSFSIGDIKQYFTLSNGQPIPSGTFTNITSD
RTIPTAQEVSQMNAGTQLYHITATNAYHKDSEDFYISLKIIDVKQPEGDQ
RVYRTSTYDLTTDEISKVKQAFINANRDVITLAEGDISVTNTPNGANVST
ITVNINKGRLTKSFASNLANMNFLRWVNFPQDYTVTWTNAKIANRPTDGG
LSWSDDHKSLIYRYDATLGTQITTNDILTMLKATTTVPGLRNNITGNEKS
QAEAGGRPNFRTTGYSQSNATTDGQRQFTLNGQVIQVLDIINPSNGYGGQ
PVTNSNTRANHSNSTVVNVNEPAANGAGAFTIDHVVKSNSTHNASDAVYK
AQLYLTPYGPKQYVEHLNQNTGNTTDAINIYFVPSDLVNPTISVGNYTNH
QVFSGE
TFTNTITANDNFGVQSVTVPNTSQITGTVDNNHQHVSATAPNVT
SATNKTINLLATDTSGNTATTSFNVTVKPLRDKYRVGTSSTAANPVRIAN
ISNNATVSQADQTTIINSLTFTETVPNRSYARASANEITSKTVSNVSRTG
NNANVTVTVTYQDGTTSTVT
VPVKHVIPEIVAHSHYTVQGQDFPAGNGSS
ASDYFKLSNGSDIADATITWVSGQAPNKDNTRIGEDITVTAHILIDGETT
PITKTATYKVVRTVPKHVFETARGVLYPGVSDMYDAKQYVKPVNNSWSTN
AQHMNFQFVGTYGPNKDVVGISTRLIRVTYDNRQTEDLTILSKVKPDPPR
IDANSVTYKAGLTNQEIKVNNVLNNSSVKLFKADNTPLNVTNITHGSGFS
SVVTVSDALPNGGIKAKSSISMNNVTYTTQDEHGQVVTVTRNESVDSNDS
ATVTVTPQLQATTEGAVFIKGGDGFDFGHVERFIQNPPHGATVAWHDSPD
TWKNTVGNTHKTAVVTLPNGQGTRNVEVPVKVYPVANAKAPSRDVKGQNL
TNGTDAMNYITFDPNTNTNGITAAWANRQQPNNQQAGVQHLNVDVTYPGI
SAAKRVPVTVNVYQFEFPQTTYTTTVGGTLASGTQASGYAHMQNATGLPT
DGFTYKWNRDTTGTNDANWSAMNKPNVAKVVNAKYDVIYNGHTFATSLPA
KFVVKDVQPAKPTVTETAAGAITIAPGANQTVNTHAGNVTTYADKLVIKR
NGNVVTTFTRRNNTSPWVKEASAATVAGIAGTNNGITVAAGTFNPADTIQ
VVATQGSGETVSDEQRSDDFTVVAPQPNQATTKIWQNGHIDITPNNPSGH
LINPTQAMDIAYTEKVGNGAEHSKTINVVRGQNNQWTIANKPDYVTLDAQ
TGKVTFNANTIKPNSSITITPKAGTGHSVSSNPSTLTAPAAHTVNTTEIV
KDYGSNVTAAEINNAVQVANKRTATIKNGTAMPTNLAGGSTTTIPVTVTY
NDGSTEEVQESIFTKADKRELIT
AKNHLDDPVSTEGKKPGTITQYNNAMH
NAQQQINTAKTEAQQVINNERATPQQVSDA
LTKVRAAQTKIDQAKALLQN
KEDNSQLVT
SKNNLQSSVNQVPSTAGMTQQSIDNYNAKKREAETEITAAQ
RVIDNGDATAQQISDE
KHRVDNALTALNQAKHDLTADTHALEQAVQQLNR
TGTTTGKKPASITAYNNSIRALQSDLTSAKNSANAIIQKPIRTVQEVQSA
LTNVNRVNERLTQAINQLVPLADNSALKTAKTKLDEEINKSVTTDGMTQS
SIQAYENAKRAGQTESTNAQNVINNGDATDQQIAAE
KTKVEEKYNSLKQA
IAGLTPDLAPLQT
AKTQLQNDIDQPTSTTGMTSASIAAFNEKLSAARTKI
QEIDRVLASHPDVATIRQN
VTAANAAKSALDQARNGLTVDKAPLENAKNQ
LQHSIDTQTSTTGMTQDSINAYNAKLTAARNKIQQINQVLAGSPTVEQIN
TN
TSTANQAKSDLDHARQALTPDKAPLQTAKTQLEQSINQPTDTTGMTTA
SLNAYNQKLQAARQKLTEINQVLNGNPTVQNINDK
VTEANQAKDQLNTAR
QGLTLDRQPALTTLHGASNLNQAQQNNFTQQINAAQNHAALETIKSNITA
LNT
AMTKLKDSVADNNTIKSDQNYTDATPANKQAYDNAVNAAKGVIGETT
NPTMDVNTVNQK
AASVKSTKDALDGQQNLQRAKTEATNAITHASDLNQAQ
KNALTQQVNSAQNVQAVNDIKQTTQSLNT
AMTGLKRGVANHNQVVQSDNY
VNADTNKKNDYNNAYNHANDIINGNAQHPVITPSDVNNA
LSNVTSKEHAL
NGEAKLNAAKQEANTALGHLNNLNNAQRQNLQSQINGAHQIDAVNTIKQN
ATNLNS
AMGNLRQAVADKDQVKRTEDYADADTAKQNAYNSAVSSAETIIN
QTTNPTMSVDDVNRA
TSAVTSNKNALNGYEKLAQSKTDAARAIDALPHLN
NAQKADVKSKINAASNIAGVNTVKQQGTDLNT
AMGNLQGAINDEQTTLNS
QNYQDATPSKKTAYTNAVQAAKDILNKSNGQNKTKDQVTEA
MNQVNSAKN
NLDGTRLLDQAKQTAKQQLNNMTHLTTAQKTNLTNQINSGTTVAGVQTVQ
SNANTLDQ
AMNTLRQSIANKDATKASEDYVDANNDKQTAYNNAVAAAETI
INANSNPEMNPSTITQK
AEQVNSSKTALNGDENLAAAKQNAKTYLNTLTS
ITDAQKNNLISQITSATRVSGVDTVKQNAQHLDQ
AMASLQNGINNESQVK
SSEKYRDADTNKQQEYDNAITAAKAILNKSTGPNTAQNAVEAA
LQRVNNA
KDALNGDAKLIAAQNAAKQHLGTLTHITTAQRNDLTNQISQATNLAGVES
VKQNANSLDG
AMGNLQTAINDKSGTLASQNFLDADEQKRNAYNQAVSAAE
TILNKQTGPNTAKTAVEQA
LNNVNNAKHALNGTQNLNNAKQAAITAINGA
SDLNQKQKDALKAQANGAQRVSNAQDVQHNATELNT
AMGTLKHAIADKTN
TLASSKYVNADSTKQNAYTTKVTNAEHIISGTPTVVTTPSEVTAA
ANQVN
SAKQELNGDERLREAKQNANTAIDALTQLNTPQKAKLKEQVGQANRLEDV
QTVQTNGQALNN
AMKGLRDSIANETTVKTSQNYTDASPNNQSTYNSAVSN
AKGIINQTNNPTMDTSAITQA
TTQVNNAKNGLNGAENLRNAQNTAKQNLN
TLSHLTNNQKSAISSQIDRAGHVSEVTATKNAATELNT
QMGNLEQAIHDQ
NTVKQSVKFTDADKAKRDAYTNAVSRAEAILNKTQGANTSKQDVEAA
IQN
VSSAKNALNGDQNVTNAKNAAKNALNNLTSINNAQKRDLTTKIDQATTVA
GVEAVSNTSTQLNT
AMANLQNGINDKTNTLASENYHDADSDKKTAYTQAV
TNAENILNKNSGSNLDKTAVENA
LSQVANAKGALNGNHNLEQAKSNANTT
INGLQHLTTAQKDKLKQQVQQAQNVAGVDTVKSSANTLNG
AMGTLRNSIQ
DNTATKNGQNYLDATERNKTNYNNAVDSANGVINATSNPNMDANAINQI
A
TQVTSTKNALDGTHNLTQAKQTATNAIDGATNLNKAQKDALKAQVTSAQR
VANVTSIQQTANELNT
AMGQLQHGIDDENATKQTQKYRDAEQSKKTAYDQ
AVAAAKAILNKQTGSNSDKAAVDRA
LQQVTSTKDALNGDAKLAEAKAAAK
QNLGTLNHITNAQRTDLEGQINQATTVDGVNTVKTNANTLDG
AMNSLQGS
INDKDATLRNQNYLDADESKRNAYTQAVTAAEGILNKQTGGNTSKADVDN
A
LNAVTRAKAALNGADNLRNAKTSATNTIDGLPNLTQLQKDNLKHQVEQA
QNVAGVNGVKDKGNTLNT
AMGALRTSIQNDNTTKTSQNYLDASDSNKNNY
NTAVNNANGVINATNNPNMDANAINGM
ANQVNTTKAALNGAQNLAQAKTN
ATNTINNAHDLNQKQKDALKTQVNNAQRVSDANNVQHTATELNS
AMTALK
AAIADKERTKASGNYVNADQEKRQAYDSKVTNAENIISGTPNATLTVNDV
NSA
ASQVNAAKTALNGDNNLRVAKEHANNTIDGLAQLNNAQKAKLKEQVQ
SATTLDGVQTVKNSSQTLNT
AMKGLRDSIANEATIKAGQNYTDASPNNRN
EYDSAVTAAKAIINQTSNPTMEPNTITQV
TSQVTTKEQALNGARNLAQAK
TTAKNNLNNLTSINNAQKDALTRSIDGATTVAGVNQETAKATELNN
AMHS
LQNGINDETQTKQTQKYLDAEPSKKSAYDQAVNAAKAILTKASGQNVDKA
AVEQA
LQNVNSTKTALNGDAKLNEAKAAAKQTLGTLTHINNAQRTALDNE
ITQATNVEGVNTVKAKAQQLDG
AMGQLETSIRDKDTTLQSQNYQDADDAK
RTAYSQAVNAAATILNKTAGGNTPKADVERA
MQAVTQANTALNGIQNLDR
AKQAANTAITNASDLNTKQKEALKAQVTSAGRVSAANGVEHTATELNT
AM
TALKRAIADKAETKASGNYVNADANKRQAYDEKVTAAENIVSGTPTPTLT
PADVTNA
ATQVTNAKTQLNGNHNLEVAKQNANTAIDGLTSLNGPQKAKLK
EQVGQATTLPNVQTVRDNAQTLNT
AMKGLRDSIANEATIKAGQNYTDASQ
NKQTDYNSAVTAAKAIIGQTTSPSMNAQEINQA
KDQVTAKQQALNGQENL
RTAQTNAKQHLNGLSDLTDAQKDAVKRQIEGATHVNEVTQAQNNADALNT
AMTNLKNGIQDQNTIKQGVNFTDADEAKRNAYTNAVTQAEQILNKAQGPN
TSKDGVETA
LENVQRAKNELNGNQNVANAKTTAKNALNNLTSINNAQKEA
LKSQIEGATTVAGVNQVSTTASELNT
AMSNLQNGINDEAATKAAQKYTDA
DREKQTAYNDAVTAAKTLLDKTAGSNDNKAAVEQA
LQRVNTAKTALNGDE
RLNEAKNTAKQQVATMSHLTDAQKANLTSQIESGTTVAGVQGIQANAGTL
DQ
AMNQLRQSIASKDATKSSEDYQDANADLQNAYNDAVTNAEGIISATNN
PEMNPDTINQK
ASQVNSAKSALNGDEKLAAAKQTAKSDIGRLTDLNNAQR
TAANAEVDQAPNLAAVTAAKNKATSLNT
AMGNLKHALAEKDNTKRSVNYT
DADQPKQQAYDTAVTQAEAITNANGSNANETQVQAA
LNQLNQAKNDLNGD
NKVAQAKESAKRALASYSNLNNAQSTAATSQIDNATTVAGVTAAQNTANE
LNT
AMGQLQNGINDQNTVKQQVNFTDADQGKKDAYTNAVTNAQGILDKAH
GQNMTKAQVEAA
LNQVTTAKNALNGDANVRQAKSDAKANLGTLTHLNNAQ
KQDLTSQIEGATTVNGVNGVKTKAQDLDG
AMQRLQSAIANKDQTKASENY
IDADPTKKTAFDNAITQAESYLNKDHGANKDKQAVEQA
IQSVTSTENALN
GDANLQRAKTEAIQAIDNLTHLNTPQKTALKQQVNAAQRVSGVTDLKNSA
TSLNN
AMDQLKQAIADHDTIVASGNYTNASPDKQGAYTDAYNAAKNIVNG
SPNVITNAADVTAA
TQRVNNAETGLNGDTNLATAKQQAKDALRQMTHLSD
AQKQSITGQIDSATQVTGVQSVKDNATNLDN
AMNQLRNSIANKDDVKASQ
PYVDADRDKQNAYNTAVTNAENIINATSQPTLDPSAVTQA
ANQVSTNKTA
LNGAQNLANKKQETTANINQLSHLNNAQKQDLNTQVTNAPNISTVNQVKT
KAEQLDQAMERLINGIQ
DKDQVKQSVNFTDADPEKQTAYNNAVTAAENII
NQANGTNANQSQVEAA
LSTVTTTKQALNGDRKVTDAKNNANQTLSTLDNL
NNAQKGAVTGNINQAHTVAEVTQAIQTAQELNT
AMGNLKNSLNDKDTTLG
SQNFADADPEKKNAYNEAVHNAENILNKSTGTNVPKDQVEAA
MNQVNATK
AALNGTQNLEKAKQHANTAIDGLSHLTNAQK
Original MNYRDKIQKFSIRKYTVGTFSTVIATLVFLGFNTSQAHAAETNQPASVVK
QKQQSNNEQTENRESQVQNSQNSQNGQSLSATHENEQPNISQANLVDQKV
AQSSTTNDEQPASQNVNTKKDSATAATTQPDKEQSKHKQNESQSANKNGN
DNRAAHVENHEANVVTASDSSDNGNVQHDRNELQAFFDANYHDYRFIDRE
NADSGTFNYVKGIFDKINTLLGSNDPINNKDLQLAYKELEQAVALIRTMP
QRQQTSRRSNRIQTRSVESRAAEPRSVSDYQNANSSYYVENANDGSGYPV
GTYINASSKGAPYNLPTTPWNTLKASDSKEIALMTAKQTGDGYQWVIKFN
KGHAPHQNMIFWFALPADQVPVGRTDFVTVNSDGTNVQWSHGAGAGANKP
LQQMWEYGVNDPHRSHDFKIRNRSGQVIYDWPTVHIYSLEDLSRASDYFS
EAGATPATKAFGRQNFEYINGQKPAESPGVPKVYTFIGQGDASYTISFKT
QGPTVNKLYYAAGGRALEYNQLFMYSQLYVESTQDHQQRLNGLRQVVNRT
YRIGTTKRVEVSQGNVQTKKVLESTNLNIDDFVDDPLSYVKTPSNKVLGF
YSNNANTNAFRPGGAQQLNEYQLSQLFTDQKLQEAARTRNPIRLMIGFDY
PDAYGNSETLVPVNLTVLPEIQHNIKFFKNDDTQNIAEKPFSKQAGHPVF
YVYAGNQGNASVNLGGSVTSIQPLRINLTSNENFTDKDWQITGIPRTLHI
ENSTNRPNNARERNIELVGNLLPGDYFGTIRFGRKEQLFEIRVKPHTPTI
TTTAEQLRGTALQKVPVNISGIPLDPSALVYLVAPTNQTTNGGSEADQIP
SGYTILATGTPDGVHNTITIRPQDYVVFIPPVGKQIRAVVYYNKVVASNM
SNAVTILPDDIPPTINNPVGINAKYYRGDEVNFTMGVSDRHSGIKNTTIT
TLPNGWTSNLTKADKNNGSLSITGRVSMNQAFNSDITFKVSATDNVNNTT
NDSQSKHVSIHVGKISEDAHPIVLGNTEKVVVVNPTAVSNDEKQSIITAF
MNKNQNIRGYLASTDPVTVDNNGNVTLHYRDGSSTTLDATNVMTYEPVVK
PEYQTVNAAKTATVTIAKGQSFSIGDIKQYFTLSNGQPIPSGTFTNITSD
RTIPTAQEVSQMNAGTQLYHITATNAYHKDSEDFYISLKIIDVKQPEGDQ
RVYRTSTYDLTTDEISKVKQAFINANRDVITLAEGDISVTNTPNGANVST
ITVNINKGRLTKSFASNLANMNFLRWVNFPQDYTVTWTNAKIANRPTDGG
LSWSDDHKSLIYRYDATLGTQITTNDILTMLKATTTVPGLRNNITGNEKS
QAEAGGRPNFRTTGYSQSNATTDGQRQFTLNGQVIQVLDIINPSNGYGGQ
PVTNSNTRANHSNSTVVNVNEPAANGAGAFTIDHVVKSNSTHNASDAVYK
AQLYLTPYGPKQYVEHLNQNTGNTTDAINIYFVPSDLVNPTISVGNYTNH
QVFSGETFTNTITANDNFGVQSVTVPNTSQITGTVDNNHQHVSATAPNVT
SATNKTINLLATDTSGNTATTSFNVTVKPLRDKYRVGTSSTAANPVRIAN
ISNNATVSQADQTTIINSLTFTETVPNRSYARASANEITSKTVSNVSRTG
NNANVTVTVTYQDGTTSTVTVPVKHVIPEIVAHSHYTVQGQDFPAGNGSS
ASDYFKLSNGSDIADATITWVSGQAPNKDNTRIGEDITVTAHILIDGETT
PITKTATYKVVRTVPKHVFETARGVLYPGVSDMYDAKQYVKPVNNSWSTN
AQHMNFQFVGTYGPNKDVVGISTRLIRVTYDNRQTEDLTILSKVKPDPPR
IDANSVTYKAGLTNQEIKVNNVLNNSSVKLFKADNTPLNVTNITHGSGFS
SVVTVSDALPNGGIKAKSSISMNNVTYTTQDEHGQVVTVTRNESVDSNDS
ATVTVTPQLQATTEGAVFIKGGDGFDFGHVERFIQNPPHGATVAWHDSPD
TWKNTVGNTHKTAVVTLPNGQGTRNVEVPVKVYPVANAKAPSRDVKGQNL
TNGTDAMNYITFDPNTNTNGITAAWANRQQPNNQQAGVQHLNVDVTYPGI
SAAKRVPVTVNVYQFEFPQTTYTTTVGGTLASGTQASGYAHMQNATGLPT
DGFTYKWNRDTTGTNDANWSAMNKPNVAKVVNAKYDVIYNGHTFATSLPA
KFVVKDVQPAKPTVTETAAGAITIAPGANQTVNTHAGNVTTYADKLVIKR
NGNVVTTFTRRNNTSPWVKEASAATVAGIAGTNNGITVAAGTFNPADTIQ
VVATQGSGETVSDEQRSDDFTVVAPQPNQATTKIWQNGHIDITPNNPSGH
LINPTQAMDIAYTEKVGNGAEHSKTINVVRGQNNQWTIANKPDYVTLDAQ
TGKVTFNANTIKPNSSITITPKAGTGHSVSSNPSTLTAPAAHTVNTTEIV
KDYGSNVTAAEINNAVQVANKRTATIKNGTAMPTNLAGGSTTTIPVTVTY
NDGSTEEVQESIFTKADKRELITAKNHLDDPVSTEGKKPGTITQYNNAMH
NAQQQINTAKTEAQQVINNERATPQQVSDALTKVRAAQTKIDQAKALLQN
KEDNSQLVTSKNNLQSSVNQVPSTAGMTQQSIDNYNAKKREAETEITAAQ
RVIDNGDATAQQISDEKHRVDNALTALNQAKHDLTADTHALEQAVQQLNR
TGTTTGKKPASITAYNNSIRALQSDLTSAKNSANAIIQKPIRTVQEVQSA
LTNVNRVNERLTQAINQLVPLADNSALKTAKTKLDEEINKSVTTDGMTQS
SIQAYENAKRAGQTESTNAQNVINNGDATDQQIAAEKTKVEEKYNSLKQA
IAGLTPDLAPLQTAKTQLQNDIDQPTSTTGMTSASIAAFNEKLSAARTKI
QEIDRVLASHPDVATIRQNVTAANAAKSALDQARNGLTVDKAPLENAKNQ
LQHSIDTQTSTTGMTQDSINAYNAKLTAARNKIQQINQVLAGSPTVEQIN
TNTSTANQAKSDLDHARQALTPDKAPLQTAKTQLEQSINQPTDTTGMTTA
SLNAYNQKLQAARQKLTEINQVLNGNPTVQNINDKVTEANQAKDQLNTAR
QGLTLDRQPALTTLHGASNLNQAQQNNFTQQINAAQNHAALETIKSNITA
LNTAMTKLKDSVADNNTIKSDQNYTDATPANKQAYDNAVNAAKGVIGETT
NPTMDVNTVNQKAASVKSTKDALDGQQNLQRAKTEATNAITHASDLNQAQ
KNALTQQVNSAQNVQAVNDIKQTTQSLNTAMTGLKRGVANHNQVVQSDNY
VNADTNKKNDYNNAYNHANDIINGNAQHPVITPSDVNNALSNVTSKEHAL
NGEAKLNAAKQEANTALGHLNNLNNAQRQNLQSQINGAHQIDAVNTIKQN
ATNLNSAMGNLRQAVADKDQVKRTEDYADADTAKQNAYNSAVSSAETIIN
QTTNPTMSVDDVNRATSAVTSNKNALNGYEKLAQSKTDAARAIDALPHLN
NAQKADVKSKINAASNIAGVNTVKQQGTDLNTAMGNLQGAINDEQTTLNS
QNYQDATPSKKTAYTNAVQAAKDILNKSNGQNKTKDQVTEAMNQVNSAKN
NLDGTRLLDQAKQTAKQQLNNMTHLTTAQKTNLTNQINSGTTVAGVQTVQ
SNANTLDQAMNTLRQSIANKDATKASEDYVDANNDKQTAYNNAVAAAETI
INANSNPEMNPSTITQKAEQVNSSKTALNGDENLAAAKQNAKTYLNTLTS
ITDAQKNNLISQITSATRVSGVDTVKQNAQHLDQAMASLQNGINNESQVK
SSEKYRDADTNKQQEYDNAITAAKAILNKSTGPNTAQNAVEAALQRVNNA
KDALNGDAKLIAAQNAAKQHLGTLTHITTAQRNDLTNQISQATNLAGVES
VKQNANSLDGAMGNLQTAINDKSGTLASQNFLDADEQKRNAYNQAVSAAE
TILNKQTGPNTAKTAVEQALNNVNNAKHALNGTQNLNNAKQAAITAINGA
SDLNQKQKDALKAQANGAQRVSNAQDVQHNATELNTAMGTLKHAIADKTN
TLASSKYVNADSTKQNAYTTKVTNAEHIISGTPTVVTTPSEVTAAANQVN
SAKQELNGDERLREAKQNANTAIDALTQLNTPQKAKLKEQVGQANRLEDV
QTVQTNGQALNNAMKGLRDSIANETTVKTSQNYTDASPNNQSTYNSAVSN
AKGIINQTNNPTMDTSAITQATTQVNNAKNGLNGAENLRNAQNTAKQNLN
TLSHLTNNQKSAISSQIDRAGHVSEVTATKNAATELNTQMGNLEQAIHDQ
NTVKQSVKFTDADKAKRDAYTNAVSRAEAILNKTQGANTSKQDVEAAIQN
VSSAKNALNGDQNVTNAKNAAKNALNNLTSINNAQKRDLTTKIDQATTVA
GVEAVSNTSTQLNTAMANLQNGINDKTNTLASENYHDADSDKKTAYTQAV
TNAENILNKNSGSNLDKTAVENALSQVANAKGALNGNHNLEQAKSNANTT
INGLQHLTTAQKDKLKQQVQQAQNVAGVDTVKSSANTLNGAMGTLRNSIQ
DNTATKNGQNYLDATERNKTNYNNAVDSANGVINATSNPNMDANAINQIA
TQVTSTKNALDGTHNLTQAKQTATNAIDGATNLNKAQKDALKAQVTSAQR
VANVTSIQQTANELNTAMGQLQHGIDDENATKQTQKYRDAEQSKKTAYDQ
AVAAAKAILNKQTGSNSDKAAVDRALQQVTSTKDALNGDAKLAEAKAAAK
QNLGTLNHITNAQRTDLEGQINQATTVDGVNTVKTNANTLDGAMNSLQGS
INDKDATLRNQNYLDADESKRNAYTQAVTAAEGILNKQTGGNTSKADVDN
ALNAVTRAKAALNGADNLRNAKTSATNTIDGLPNLTQLQKDNLKHQVEQA
QNVAGVNGVKDKGNTLNTAMGALRTSIQNDNTTKTSQNYLDASDSNKNNY
NTAVNNANGVINATNNPNMDANAINGMANQVNTTKAALNGAQNLAQAKTN
ATNTINNAHDLNQKQKDALKTQVNNAQRVSDANNVQHTATELNSAMTALK
AAIADKERTKASGNYVNADQEKRQAYDSKVTNAENIISGTPNATLTVNDV
NSAASQVNAAKTALNGDNNLRVAKEHANNTIDGLAQLNNAQKAKLKEQVQ
SATTLDGVQTVKNSSQTLNTAMKGLRDSIANEATIKAGQNYTDASPNNRN
EYDSAVTAAKAIINQTSNPTMEPNTITQVTSQVTTKEQALNGARNLAQAK
TTAKNNLNNLTSINNAQKDALTRSIDGATTVAGVNQETAKATELNNAMHS
LQNGINDETQTKQTQKYLDAEPSKKSAYDQAVNAAKAILTKASGQNVDKA
AVEQALQNVNSTKTALNGDAKLNEAKAAAKQTLGTLTHINNAQRTALDNE
ITQATNVEGVNTVKAKAQQLDGAMGQLETSIRDKDTTLQSQNYQDADDAK
RTAYSQAVNAAATILNKTAGGNTPKADVERAMQAVTQANTALNGIQNLDR
AKQAANTAITNASDLNTKQKEALKAQVTSAGRVSAANGVEHTATELNTAM
TALKRAIADKAETKASGNYVNADANKRQAYDEKVTAAENIVSGTPTPTLT
PADVTNAATQVTNAKTQLNGNHNLEVAKQNANTAIDGLTSLNGPQKAKLK
EQVGQATTLPNVQTVRDNAQTLNTAMKGLRDSIANEATIKAGQNYTDASQ
NKQTDYNSAVTAAKAIIGQTTSPSMNAQEINQAKDQVTAKQQALNGQENL
RTAQTNAKQHLNGLSDLTDAQKDAVKRQIEGATHVNEVTQAQNNADALNT
AMTNLKNGIQDQNTIKQGVNFTDADEAKRNAYTNAVTQAEQILNKAQGPN
TSKDGVETALENVQRAKNELNGNQNVANAKTTAKNALNNLTSINNAQKEA
LKSQIEGATTVAGVNQVSTTASELNTAMSNLQNGINDEAATKAAQKYTDA
DREKQTAYNDAVTAAKTLLDKTAGSNDNKAAVEQALQRVNTAKTALNGDE
RLNEAKNTAKQQVATMSHLTDAQKANLTSQIESGTTVAGVQGIQANAGTL
DQAMNQLRQSIASKDATKSSEDYQDANADLQNAYNDAVTNAEGIISATNN
PEMNPDTINQKASQVNSAKSALNGDEKLAAAKQTAKSDIGRLTDLNNAQR
TAANAEVDQAPNLAAVTAAKNKATSLNTAMGNLKHALAEKDNTKRSVNYT
DADQPKQQAYDTAVTQAEAITNANGSNANETQVQAALNQLNQAKNDLNGD
NKVAQAKESAKRALASYSNLNNAQSTAATSQIDNATTVAGVTAAQNTANE
LNTAMGQLQNGINDQNTVKQQVNFTDADQGKKDAYTNAVTNAQGILDKAH
GQNMTKAQVEAALNQVTTAKNALNGDANVRQAKSDAKANLGTLTHLNNAQ
KQDLTSQIEGATTVNGVNGVKTKAQDLDGAMQRLQSAIANKDQTKASENY
IDADPTKKTAFDNAITQAESYLNKDHGANKDKQAVEQAIQSVTSTENALN
GDANLQRAKTEAIQAIDNLTHLNTPQKTALKQQVNAAQRVSGVTDLKNSA
TSLNNAMDQLKQAIADHDTIVASGNYTNASPDKQGAYTDAYNAAKNIVNG
SPNVITNAADVTAATQRVNNAETGLNGDTNLATAKQQAKDALRQMTHLSD
AQKQSITGQIDSATQVTGVQSVKDNATNLDNAMNQLRNSIANKDDVKASQ
PYVDADRDKQNAYNTAVTNAENIINATSQPTLDPSAVTQAANQVSTNKTA
LNGAQNLANKKQETTANINQLSHLNNAQKQDLNTQVTNAPNISTVNQVKT
KAEQLDQAMERLINGIQDKDQVKQSVNFTDADPEKQTAYNNAVTAAENII
NQANGTNANQSQVEAALSTVTTTKQALNGDRKVTDAKNNANQTLSTLDNL
NNAQKGAVTGNINQAHTVAEVTQAIQTAQELNTAMGNLKNSLNDKDTTLG
SQNFADADPEKKNAYNEAVHNAENILNKSTGTNVPKDQVEAAMNQVNATK
AALNGTQNLEKAKQHANTAIDGLSHLTNAQK
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11