Signal Peptide Database - Bacteria

 Entry Details
ID   252
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P0ADB8    (Created: 2005-12-06 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ECNB_ECOL6
Protein Name   Entericidin B
Gene   ecnB
Organism Scientific   Escherichia coli O6
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Enterobacteriales
        Enterobacteriaceae
          Escherichia
Protein Length [aa]   48
Protein Mass [Da]   4810
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   21
lipid moiety-binding region   N-palmitoyl cysteine   probable   22   22
lipid moiety-binding region   S-diacylglycerol cysteine   probable   22   22
peptide   Entericidin B. /FTId=PRO_0000043193      22   48
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MVKKTIAAIFSVLVLSTVLTA
Sequence MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ
Original MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11