Signal Peptide Database - Bacteria

 Entry Details
ID   282
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q02307    (Created: 1993-07-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   ETXB_CLOPE
Protein Name   Epsilon-toxin type B
Gene   etxB
Organism Scientific   Clostridium perfringens
Organism Common  
Lineage   Bacteria
  Firmicutes
    Clostridia
      Clostridiales
        Clostridiaceae
          Clostridium
Protein Length [aa]   328
Protein Mass [Da]   36396
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   32
chain   Epsilon-toxin type B      46   328
propeptide   Removed in mature form      33   45
SP Length   32
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKKNLVKSLAIASAVISIYSIVNIVSPTNVIA
Sequence MKKNLVKSLAIASAVISIYSIVNIVSPTNVIAKEISNTVSNEMSKKASYD
NVDTLIEKGRYNTKYNYLKRMEKYYPNAMAYFDKVTINPQGNDFYINNPK
VELDGEPSMNYLEDVYVGKALLTNDTQQEQKLKSQSFTCKNTDTVTATTT
HTVGTSIQATAKFTVPFNETGVSLTTSYSFANTNTNTNSKEITHNVPSQD
ILVPANTTVEVIAYLKKVNVKGNVKLVGQVSGSEWGEIPSYLAFPRDGYK
FSLSDTVNKSDLNEDGTININGKGNYSAVMGDELIVKVRNLNTNNVQEYV
IPVDKKEKSNDSNIVKYRSLYIKAPGIK
Original MKKNLVKSLAIASAVISIYSIVNIVSPTNVIAKEISNTVSNEMSKKASYD
NVDTLIEKGRYNTKYNYLKRMEKYYPNAMAYFDKVTINPQGNDFYINNPK
VELDGEPSMNYLEDVYVGKALLTNDTQQEQKLKSQSFTCKNTDTVTATTT
HTVGTSIQATAKFTVPFNETGVSLTTSYSFANTNTNTNSKEITHNVPSQD
ILVPANTTVEVIAYLKKVNVKGNVKLVGQVSGSEWGEIPSYLAFPRDGYK
FSLSDTVNKSDLNEDGTININGKGNYSAVMGDELIVKVRNLNTNNVQEYV
IPVDKKEKSNDSNIVKYRSLYIKAPGIK
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11