Signal Peptide Database - Bacteria

 Entry Details
ID   29
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q06062    (Created: 2003-07-25 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   ALGF_PSEAE
Protein Name   Alginate biosynthesis protein algF
Gene   algF
Organism Scientific   Pseudomonas aeruginosa
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Pseudomonadales
        Pseudomonadaceae
          Pseudomonas
Protein Length [aa]   216
Protein Mass [Da]   22834
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   28
chain   Alginate biosynthesis protein algF      29   216
SP Length   28
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MNPMTRRHTWTRLACALSLGVAAFAAQA
Sequence MNPMTRRHTWTRLACALSLGVAAFAAQADEGALYGPQAPKGSAFVRAYNA
GNSELDVSVGSTSLNDVAPLGSSDFKFLPPGSYTAQVGQQSLPVKLDPDS
YYTLVSQPGGKPQLVAEPPFKNKQKALVRVQNLSGSKLTLKTADGKTDVV
KDVGPQSHGDREINPVKVNLALFDGSKKVSDLKPVTLARGEVVCLYVTGS
GGKLAPVWVKRPVKAD
Original MNPMTRRHTWTRLACALSLGVAAFAAQADEGALYGPQAPKGSAFVRAYNA
GNSELDVSVGSTSLNDVAPLGSSDFKFLPPGSYTAQVGQQSLPVKLDPDS
YYTLVSQPGGKPQLVAEPPFKNKQKALVRVQNLSGSKLTLKTADGKTDVV
KDVGPQSHGDREINPVKVNLALFDGSKKVSDLKPVTLARGEVVCLYVTGS
GGKLAPVWVKRPVKAD
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11