Signal Peptide Database - Bacteria

 Entry Details
ID   34
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P00811    (Created: 1986-07-21 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   AMPC_ECOLI
Protein Name   Beta-lactamase
Gene   ampC
Organism Scientific   Escherichia coli (strain K12)
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Enterobacteriales
        Enterobacteriaceae
          Escherichia
Protein Length [aa]   377
Protein Mass [Da]   41556
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   19
chain   Beta-lactamase      20   377
region of interest   Substrate binding   by similarity   331   333
strand         42   50
strand         53   63
strand         75   77
strand         162   164
strand         204   206
strand         218   220
strand         223   225
strand         273   278
strand         281   283
strand         288   293
strand         306   308
strand         315   321
strand         325   334
strand         339   345
strand         350   358
helix         22   39
helix         79   81
helix         82   95
helix         105   107
helix         115   117
helix         122   126
helix         144   153
helix         168   178
helix         186   193
helix         209   214
helix         233   236
helix         243   254
helix         256   258
helix         262   271
helix         296   301
helix         346   348
helix         362   376
active site   Acyl-ester intermediate      80   80
active site   Proton acceptor      166   166
mutagenesis site   Lowers activity more than 1000- fold and increases protein stability      0   0
mutagenesis site   Lowers activity more than 1000- fold      0   0
mutagenesis site   Lowers activity more than 1000- fold      0   0
mutagenesis site   Lowers activity more than 1000- fold      0   0
mutagenesis site   Loss of activity      0   0
turn         64   67
turn         179   183
turn         194   199
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MFKTTLCALLITASCSTFA
Sequence MFKTTLCALLITASCSTFAAPQQINDIVHRTITPLIEQQKIPGMAVAVIY
QGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIK
LSDP
TTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRF
YQN
WQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKL
NHT
WINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWV
QSNL
KPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSII
N
GSDNKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKEL
GIVMLANK
NYPNPARVDAAWQILNALQ
Original MFKTTLCALLITASCSTFAAPQQINDIVHRTITPLIEQQKIPGMAVAVIY
QGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIK
LSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRF
YQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKL
NHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWV
QSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSII
NGSDNKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKEL
GIVMLANKNYPNPARVDAAWQILNALQ
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11