Signal Peptide Database - Bacteria

 Entry Details
ID   36
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q01693    (Created: 1993-07-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   AMPX_VIBPR
Protein Name   Bacterial leucyl aminopeptidase
Gene  
Organism Scientific   Vibrio proteolyticus
Organism Common   Aeromonas proteolytica
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Vibrionales
        Vibrionaceae
          Vibrio
Protein Length [aa]   504
Protein Mass [Da]   54232
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   21
chain   Bacterial leucyl aminopeptidase      107   405
disulfide bond         329   333
strand         169   174
strand         183   188
strand         191   203
strand         246   255
strand         277   283
strand         292   299
strand         324   327
strand         346   352
helix         113   119
helix         120   122
helix         125   136
helix         146   163
helix         225   240
helix         257   259
helix         262   273
helix         305   318
helix         336   341
helix         354   356
helix         368   370
helix         376   394
propeptide      potential   22   106
propeptide   Removed in mature form   potential   406   504
metal ion-binding site   Zinc 1      203   203
metal ion-binding site   Zinc 2; catalytic      223   223
metal ion-binding site   Zinc 1      223   223
metal ion-binding site   Zinc 2; catalytic      258   258
metal ion-binding site   Zinc 1      285   285
metal ion-binding site   Zinc 2; catalytic      362   362
turn         221   224
turn         359   362
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKYTKTLLAMVLSATFCQAYA
Sequence MKYTKTLLAMVLSATFCQAYAEDKVWISIGADANQTVMKSGAESILPNSV
ASSGQVWVGQVDVAQLAELSHNMHEEHNRCGGYMVHPSAQSAMAASAMPT
TLASFV
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQ
ASDWIASEWQALS
ASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVI
GG
HLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIA
FMAYA
AEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFIT
DYTD
SNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPF
ES
KFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATGDTP
TPGNQ
LEDGVPVTDLSGSRGSNVWYTFELETQKNLQITTSGGYGDLDLYV
KFGSKASKQNWDCRPYLSGNNEVCTFNNASPGTYSVMLTGYSNYSGASLK
ASTF
Original MKYTKTLLAMVLSATFCQAYAEDKVWISIGADANQTVMKSGAESILPNSV
ASSGQVWVGQVDVAQLAELSHNMHEEHNRCGGYMVHPSAQSAMAASAMPT
TLASFVMPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQ
ASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVI
GGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIA
FMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFIT
DYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPF
ESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATGDTP
TPGNQLEDGVPVTDLSGSRGSNVWYTFELETQKNLQITTSGGYGDLDLYV
KFGSKASKQNWDCRPYLSGNNEVCTFNNASPGTYSVMLTGYSNYSGASLK
ASTF
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11