Signal Peptide Database - Bacteria

 Entry Details
ID   78
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P14559    (Created: 1990-01-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   BLAC_STRAL
Protein Name   Beta-lactamase
Gene  
Organism Scientific   Streptomyces albus G
Organism Common  
Lineage   Bacteria
  Actinobacteria
    Actinobacteridae
      Actinomycetales
        Streptomycineae
          Streptomycetaceae
            Streptomyces
Protein Length [aa]   314
Protein Mass [Da]   33265
Features  
TypeDescriptionStatusStartEnd
signal peptide   Tat-type signal      1   39
chain   Beta-lactamase      40   314
region of interest   Substrate binding   by similarity   259   261
strand         62   70
strand         76   80
strand         105   107
strand         221   224
strand         254   262
strand         268   275
strand         282   289
helix         48   60
helix         88   91
helix         92   102
helix         118   124
helix         134   139
helix         144   153
helix         157   167
helix         171   179
helix         193   195
helix         208   219
helix         226   237
helix         246   249
helix         299   312
active site   Acyl-ester intermediate      89   89
turn         71   73
turn         108   111
turn         129   132
turn         243   245
SP Length   39
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MHPSTSRPSRRTLLTATAGAALAAATLVPGTAHASSGGR
Sequence MHPSTSRPSRRTLLTATAGAALAAATLVPGTAHASSGGRGHGSGSVSDAE
RRLAGLERAS
GARLGVYAYDTGSGRTVAYRADELFPMCSVFKTLSSAAVL
RD
LDRNGEFLSRRILYTQDDVEQADGAGPETGKPQNLANAQLTVEELCEV
SIT
ASDNCAANLMLRELGGPAAVTRFVRSLGDRVTRLDRWEPELNSAEPG
RVTDTTS
PRAITRTYGRLVLGDALNPRDRRLLTSWLLANTTSGDRFRAGL
PDD
WTLGDKTGAGRYGTNNDAGVTWPPGRAPIVLTVLTAKTEQDAARDDG
LVADAARVLAET
LG
Original MHPSTSRPSRRTLLTATAGAALAAATLVPGTAHASSGGRGHGSGSVSDAE
RRLAGLERASGARLGVYAYDTGSGRTVAYRADELFPMCSVFKTLSSAAVL
RDLDRNGEFLSRRILYTQDDVEQADGAGPETGKPQNLANAQLTVEELCEV
SITASDNCAANLMLRELGGPAAVTRFVRSLGDRVTRLDRWEPELNSAEPG
RVTDTTSPRAITRTYGRLVLGDALNPRDRRLLTSWLLANTTSGDRFRAGL
PDDWTLGDKTGAGRYGTNNDAGVTWPPGRAPIVLTVLTAKTEQDAARDDG
LVADAARVLAETLG
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11