Signal Peptide Database - Bacteria

 Entry Details
ID   8
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q05862    (Created: 1994-02-01 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   A85C_MYCLE
Protein Name   Antigen 85-C
Gene   fbpC
Organism Scientific   Mycobacterium leprae
Organism Common  
Lineage   Bacteria
  Actinobacteria
    Actinobacteridae
      Actinomycetales
        Corynebacterineae
          Mycobacteriaceae
            Mycobacterium
Protein Length [aa]   333
Protein Mass [Da]   36392
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   46
chain   Antigen 85-C      47   333
region of interest   Fibronectin-binding      102   112
active site   Acyl-ester intermediate   by similarity   170   170
active site      by similarity   274   274
active site      by similarity   306   306
SP Length   46
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKFLQQMRKLFGLAAKFPARLTIAVIGTALLAGLVGVVGDTAIAVA
Sequence MKFLQQMRKLFGLAAKFPARLTIAVIGTALLAGLVGVVGDTAIAVAFSKP
GLPVEYLQVPSPSMGHDIKIQFQGGGQHAVYLLDGLRAQEDYNGWDINTP
A
FEEYYHSGLSVIMPVGGQSSFYSNWYQPSQGNGQHYTYKWETFLTQEMP
SWLQANKNVLPTGNAAVGL
SMSGSSALILASYYPQQFPYAASLSGFLNPS
EGWWPTMIGLAMNDSGGYNANSMWGPSTDPAWKRNDPMVQIPRLVANNTR
IWVYCGNGAPNELGGDNIPAKFL
ESLTLSTNEIFQNTYAASGGRNGVFNF
PPNGT
HSWPYWNQQLVAMKPDIQQILNGSNNNA
Original MKFLQQMRKLFGLAAKFPARLTIAVIGTALLAGLVGVVGDTAIAVAFSKP
GLPVEYLQVPSPSMGHDIKIQFQGGGQHAVYLLDGLRAQEDYNGWDINTP
AFEEYYHSGLSVIMPVGGQSSFYSNWYQPSQGNGQHYTYKWETFLTQEMP
SWLQANKNVLPTGNAAVGLSMSGSSALILASYYPQQFPYAASLSGFLNPS
EGWWPTMIGLAMNDSGGYNANSMWGPSTDPAWKRNDPMVQIPRLVANNTR
IWVYCGNGAPNELGGDNIPAKFLESLTLSTNEIFQNTYAASGGRNGVFNF
PPNGTHSWPYWNQQLVAMKPDIQQILNGSNNNA
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11