Signal Peptide Database - Bacteria

 Entry Details
ID   82
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   O50712    (Created: 2006-05-30 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   BPTA_BORBU
Protein Name   Protein bptA
Gene   bptA
Organism Scientific   Borrelia burgdorferi
Organism Common   Lyme disease spirochete
Lineage   Bacteria
  Spirochaetes
    Spirochaetales
      Spirochaetaceae
        Borrelia
          Borrelia burgdorferi group
Protein Length [aa]   206
Protein Mass [Da]   24534
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   19
chain   Protein bptA      20   206
sequence variant   (in strain: 297)      0   0
sequence variant   (in strain: 297)      0   0
sequence variant   (in strain: 297, N40)      0   0
sequence variant   (in strain: N40)      0   0
sequence variant   (in strain: N40)      0   0
sequence variant   (in strain: N40)      0   0
sequence variant   (in strain: N40)      0   0
sequence variant   (in strain: N40)      0   0
sequence variant   (in strain: 297, N40)      0   0
sequence variant   (in strain: 297)      0   0
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MGKILFFGLLLICIFLGFF
Sequence MGKILFFGLLLICIFLGFFFYKQKENNVIYNKIVEKFDDNVFVDETYTYL
FKDSNLKELVFIKSQLIIPELKHKKMIKATGYRADAYKALSTVYRFDFKV
HDNKILGFKSVIFEGFEDAKVSKHENNLPSEKWQQLKDFNIGDPNINEKF
FHLEFPFVVKNTLCVTISKGFFKKIKKLKRLKIMLISNEDREYKIDIENF
LPKYNL
Original MGKILFFGLLLICIFLGFFFYKQKENNVIYNKIVEKFDDNVFVDETYTYL
FKDSNLKELVFIKSQLIIPELKHKKMIKATGYRADAYKALSTVYRFDFKV
HDNKILGFKSVIFEGFEDAKVSKHENNLPSEKWQQLKDFNIGDPNINEKF
FHLEFPFVVKNTLCVTISKGFFKKIKKLKRLKIMLISNEDREYKIDIENF
LPKYNL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11