Signal Peptide Database - Bacteria

 Entry Details
ID   83
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P21175    (Created: 1991-05-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   BRAC_PSEAE
Protein Name   Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein
Gene   braC
Organism Scientific   Pseudomonas aeruginosa
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Pseudomonadales
        Pseudomonadaceae
          Pseudomonas
Protein Length [aa]   373
Protein Mass [Da]   39769
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   26
chain   Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein      27   373
disulfide bond         80   105
SP Length   26
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKKGTQRLSRLFAAMAIAGFASYSMA
Sequence MKKGTQRLSRLFAAMAIAGFASYSMAADTIKIALAGPVTGPVAQYGDMQR
AGALMAIEQINKAGGVNGAQLEGVIYDDA
CDPKQAVAVANKVVNDGVKFV
VGHVC
SSSTQPATDIYEDEGVLMITPSATAPEITSRGYKLIFRTIGLDNM
QGPVAGKFIAERYKDKTIAVLHDKQQYGEGIATEVKKTVEDAGIKVAVFE
GLNAGDKDFNALISKLKKAGVQFVYFGGYHPEMGLLLRQAKQAGLDARFM
GPEGVGNSEITAIAGDASEGMLATLPRAFEQDPKNKALIDAFKAKNQDPS
GIFVLPAYSAVTVIAKGIEKAGEADPEKVAEALRANTFETPTGNLGFDEK
GDLKNFDFTVYEWHKDATRTEVK
Original MKKGTQRLSRLFAAMAIAGFASYSMAADTIKIALAGPVTGPVAQYGDMQR
AGALMAIEQINKAGGVNGAQLEGVIYDDACDPKQAVAVANKVVNDGVKFV
VGHVCSSSTQPATDIYEDEGVLMITPSATAPEITSRGYKLIFRTIGLDNM
QGPVAGKFIAERYKDKTIAVLHDKQQYGEGIATEVKKTVEDAGIKVAVFE
GLNAGDKDFNALISKLKKAGVQFVYFGGYHPEMGLLLRQAKQAGLDARFM
GPEGVGNSEITAIAGDASEGMLATLPRAFEQDPKNKALIDAFKAKNQDPS
GIFVLPAYSAVTVIAKGIEKAGEADPEKVAEALRANTFETPTGNLGFDEK
GDLKNFDFTVYEWHKDATRTEVK
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11