Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1040
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P67807    (Created: 2004-10-11 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   A70A_DROSI
Protein Name   Accessory gland-specific peptide 70A
Gene   Acp70A
Organism Scientific   Drosophila simulans
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   55
Protein Mass [Da]   6424
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   19
chain   Accessory gland-specific peptide 70A      20   55
modified residue   Hydroxyproline   by similarity   28   28
modified residue   Hydroxyproline   by similarity   32   32
modified residue   Hydroxyproline   by similarity   34   34
modified residue   Hydroxyproline   by similarity   38   38
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKTLSLFLVLVCLLGLVQS
Sequence MKTLSLFLVLVCLLGLVQSWEWPWNRKPTKYPIPSPNPRDKWCRLNLGPA
WGGRC
Original MKTLSLFLVLVCLLGLVQSWEWPWNRKPTKYPIPSPNPRDKWCRLNLGPA
WGGRC
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11