Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1719
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9V4A7    (Created: 2006-09-05 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   PLXB_DROME
Protein Name   Plexin-B
Gene   plexB
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   2051
Protein Mass [Da]   231680
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   33
chain   Plexin-B      34   2051
transmembrane region      potential   1381   1401
topological domain   Extracellular   potential   34   1380
topological domain   Cytoplasmic   potential   1402   2051
domain   Sema      61   533
domain   PSI 1      535   587
domain   PSI 2      683   730
domain   PSI 3      834   880
domain   IPT/TIG 1      888   975
domain   IPT/TIG 2      977   1064
domain   IPT/TIG 3      1097   1193
region of interest   Interaction with PlexA      1402   1784
region of interest   Interaction with activated Rac1 and Rac2      1722   1728
region of interest   Interaction with Rho1      1788   1827
glycosylation site   N-linked (GlcNAc...)   potential   68   68
glycosylation site   N-linked (GlcNAc...)   potential   198   198
glycosylation site   N-linked (GlcNAc...)   potential   276   276
glycosylation site   N-linked (GlcNAc...)   potential   400   400
glycosylation site   N-linked (GlcNAc...)   potential   455   455
glycosylation site   N-linked (GlcNAc...)   potential   541   541
glycosylation site   N-linked (GlcNAc...)   potential   863   863
glycosylation site   N-linked (GlcNAc...)   potential   1053   1053
glycosylation site   N-linked (GlcNAc...)   potential   1092   1092
glycosylation site   N-linked (GlcNAc...)   potential   1140   1140
glycosylation site   N-linked (GlcNAc...)   potential   1181   1181
glycosylation site   N-linked (GlcNAc...)   potential   1307   1307
glycosylation site   N-linked (GlcNAc...)   potential   1316   1316
coiled-coil region      potential   1402   1451
SP Length   33
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLRKELYCANIIHVLHVLCIIIILGSQHYCVNC
Sequence MLRKELYCANIIHVLHVLCIIIILGSQHYCVNCIEELPAQALSPLNDIVA
QFNLPSIPVQ
STASSYGNRSIGNNIESVRDSQSKNYFTHMSFDFMHNVLF
AGATNKILKLNENLRVLAEAVTGPLHDSPQCHAGGCPEDIETSLVNNFNK
ILVVSYAHDGILIACGSIRQGACEIYSLPRFPATPQFFAVPLAANDE
NAS
TYAFVGPARYAWKEEDILYVGTTFTNVGDYRHDVPAISSRRLDDLNYAEF
SIQQSIINIDVKYRDHFLVDYIYGF
NSSEYAYFIIVQKKSHLADEAGYVT
RLARICITDPNYDSYTEITVQCTATENNVDYNIVRDAKVTPASHKLAQKM
GIKKDDHVLVTVFSPSREISNQPESKSAMCIYSIKDIEDMFIENIHLCF
N
GTTKDRNLGYISGTINDGRCPIVGSLGNIYNFCSVGLKISGVSPITAHAL
FHFD
NVSVTSVTATSTTDQQHSLAFLGTNMGVIKKVLLSGQSPGEYEEIV
VDAGNRILPNTMMSPKKDFLYVLSQRKITKLRI
EHCSVYTNCSACLESRD
PFCGWCSLEKRCTVRSTCQRDTSASRWLSLGSGQQCI
EFESIIPEKIPIS
ELSHLHLIIRTLPEPFNAKYRCVFGNSTPIDAEILENGLGCATPPLDERP
LIPTNTDHILVPLSVRSSETNKDFVSRNFAFF
DCSHHGNCQECLQSSWGC
NWCIFDNKCVHKSLQCRNIENAVSTVGHCP
HLKKNRPEILLPVRVPIEIR
LEIENLPKPKSAHAGFLCTIHIEAAQMLLPAHVESNKIVVCEKTPYFYEI
NTHEYQAKVVVTWNFQHYVDTAIVTLYKCDVLG
SHREHPDCSLCVTRDPK
YKCAWCSNSCVY
NETCIADKNSISSGSKSAIENECPLPRIDIIKPLSGPV
EGGTLITIEGSNLGIREEDVRGKIFIGSVPCELENYQISVKIECRTGASL
YEMSAPIKVANDAGFTESSVQFHFK
NVLLTGLYPTIGPRSGGTQLSLIGK
FLNIGSTMRAFLDEYECHIDVTQASSSQVSCTTSEATQPEPIRSLHLVID
GA
NRTLECQISTPSITNTNPTRSNFGSYQLRSLPRQPCSIFNYTQDPRIM
QIKPLRSFKSGGRVLTVHGIYLNSIQKPELEVFYDNERV
NKTSCVVINSN
QMECPSPPVNYKFETFKKTNRKMDTELHLQ
NSSFQTETRYKNEYDRKKRR
ADFGDTFRLYTNAGSSANYFVNNNMDVTTFVKVHETQLNLQLSFVMDNVQ
LVRNLNKYFHDIRSTIVYLADPKYLPFPNDGVKLYKGDSLVIEGELLNLA
ADEYDV
NVTIGTSQCNITSLALNQLLCIPPEQQPLPTDENGVDQSTDLPL
VVVKVGRNLRFVIGYLKYDLNKPYVFSHAL
LVGILTVALLVVVFVIVLII
F
RRKSTQAEREYKRIQIQMITLESNVRSECKQAFAELQTDMTDLTADLES
T
GIPTLDHVNYIMKVFFPGVSDHPILNSPKFREGSPQTNYDAAMVQFEQL
IGNKYFLLMFIETLEAQRSSFSIRDRVNVASLIMVVLMNKMEYATEILKS
LLLRLIDKSLASKHPQLMLRRTESVVEKMLTNYLAICMYDYLKEYAGSNL
FLLFKAIKHQIEKGLVDAITNDARYSLSEERLLHEQVTHSVVILHILQDD
LDEKVQCRVNDWDTISQVKLKILDAIFKNTPFSMRPSVNEVDLEWRHGRG
GHLTLQDEDLTTKTVNGWKRL
NTLAHYGVKESAVMSLIARQNDNYHIPYS
KNQNSAPYHNFYFINNSQSHIIINNDIESGLQQP
RVYHLVKPNIPDHYMN
IKNSVLSGGSPAFQSHVVNNCNDRVNK
TIPEVYLTRLLATKGTIQKFVDD
FFSIILTVNEELPPAVKWLFDLLDEAARRHDIADTDIVHAWKSNCLPLRF
WVNFIKNPDFIFDVNKTYSVDSCLSVIAQTFMDACSTSEHRLGKDSPSNK
LLFAKDIPNYRIMVKEFYRDVSRLPQISDQEMSTAMQQLSVRQNEEFDTI
SALKELYIYITKYKDQIMESLETDINCRKMHLSRKLGNVAATLDGDCTSN
C
Original MLRKELYCANIIHVLHVLCIIIILGSQHYCVNCIEELPAQALSPLNDIVA
QFNLPSIPVQSTASSYGNRSIGNNIESVRDSQSKNYFTHMSFDFMHNVLF
AGATNKILKLNENLRVLAEAVTGPLHDSPQCHAGGCPEDIETSLVNNFNK
ILVVSYAHDGILIACGSIRQGACEIYSLPRFPATPQFFAVPLAANDENAS
TYAFVGPARYAWKEEDILYVGTTFTNVGDYRHDVPAISSRRLDDLNYAEF
SIQQSIINIDVKYRDHFLVDYIYGFNSSEYAYFIIVQKKSHLADEAGYVT
RLARICITDPNYDSYTEITVQCTATENNVDYNIVRDAKVTPASHKLAQKM
GIKKDDHVLVTVFSPSREISNQPESKSAMCIYSIKDIEDMFIENIHLCFN
GTTKDRNLGYISGTINDGRCPIVGSLGNIYNFCSVGLKISGVSPITAHAL
FHFDNVSVTSVTATSTTDQQHSLAFLGTNMGVIKKVLLSGQSPGEYEEIV
VDAGNRILPNTMMSPKKDFLYVLSQRKITKLRIEHCSVYTNCSACLESRD
PFCGWCSLEKRCTVRSTCQRDTSASRWLSLGSGQQCIEFESIIPEKIPIS
ELSHLHLIIRTLPEPFNAKYRCVFGNSTPIDAEILENGLGCATPPLDERP
LIPTNTDHILVPLSVRSSETNKDFVSRNFAFFDCSHHGNCQECLQSSWGC
NWCIFDNKCVHKSLQCRNIENAVSTVGHCPHLKKNRPEILLPVRVPIEIR
LEIENLPKPKSAHAGFLCTIHIEAAQMLLPAHVESNKIVVCEKTPYFYEI
NTHEYQAKVVVTWNFQHYVDTAIVTLYKCDVLGSHREHPDCSLCVTRDPK
YKCAWCSNSCVYNETCIADKNSISSGSKSAIENECPLPRIDIIKPLSGPV
EGGTLITIEGSNLGIREEDVRGKIFIGSVPCELENYQISVKIECRTGASL
YEMSAPIKVANDAGFTESSVQFHFKNVLLTGLYPTIGPRSGGTQLSLIGK
FLNIGSTMRAFLDEYECHIDVTQASSSQVSCTTSEATQPEPIRSLHLVID
GANRTLECQISTPSITNTNPTRSNFGSYQLRSLPRQPCSIFNYTQDPRIM
QIKPLRSFKSGGRVLTVHGIYLNSIQKPELEVFYDNERVNKTSCVVINSN
QMECPSPPVNYKFETFKKTNRKMDTELHLQNSSFQTETRYKNEYDRKKRR
ADFGDTFRLYTNAGSSANYFVNNNMDVTTFVKVHETQLNLQLSFVMDNVQ
LVRNLNKYFHDIRSTIVYLADPKYLPFPNDGVKLYKGDSLVIEGELLNLA
ADEYDVNVTIGTSQCNITSLALNQLLCIPPEQQPLPTDENGVDQSTDLPL
VVVKVGRNLRFVIGYLKYDLNKPYVFSHALLVGILTVALLVVVFVIVLII
FRRKSTQAEREYKRIQIQMITLESNVRSECKQAFAELQTDMTDLTADLES
TGIPTLDHVNYIMKVFFPGVSDHPILNSPKFREGSPQTNYDAAMVQFEQL
IGNKYFLLMFIETLEAQRSSFSIRDRVNVASLIMVVLMNKMEYATEILKS
LLLRLIDKSLASKHPQLMLRRTESVVEKMLTNYLAICMYDYLKEYAGSNL
FLLFKAIKHQIEKGLVDAITNDARYSLSEERLLHEQVTHSVVILHILQDD
LDEKVQCRVNDWDTISQVKLKILDAIFKNTPFSMRPSVNEVDLEWRHGRG
GHLTLQDEDLTTKTVNGWKRLNTLAHYGVKESAVMSLIARQNDNYHIPYS
KNQNSAPYHNFYFINNSQSHIIINNDIESGLQQPRVYHLVKPNIPDHYMN
IKNSVLSGGSPAFQSHVVNNCNDRVNKTIPEVYLTRLLATKGTIQKFVDD
FFSIILTVNEELPPAVKWLFDLLDEAARRHDIADTDIVHAWKSNCLPLRF
WVNFIKNPDFIFDVNKTYSVDSCLSVIAQTFMDACSTSEHRLGKDSPSNK
LLFAKDIPNYRIMVKEFYRDVSRLPQISDQEMSTAMQQLSVRQNEEFDTI
SALKELYIYITKYKDQIMESLETDINCRKMHLSRKLGNVAATLDGDCTSN
C
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11