Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   2544
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P11997    (Created: 1989-10-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   LSP1G_DROME
Protein Name   Larval serum protein 1 gamma chain
Gene   Lsp1gamma
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   772
Protein Mass [Da]   93408
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   16
chain   Larval serum protein 1 gamma chain      17   772
glycosylation site   N-linked (GlcNAc...)   potential   242   242
SP Length   16
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKLTLVILALVACVTA
Sequence MKLTLVILALVACVTAFSVPTQKVKIADKNFLEKQKFLFEIVHRIDEPLM
FEEWIKMGQKLITDKAQYETFDFYMEKLWESYKLGALLPKGEFFGALVKT
HHKQAYGLFNFFYYAKDWETFVRNVAWARIHVNEGMFVYALTLAVIHKPE
FEGLILPQIYEIFPQYFFNSKFVYAAEKFDYEVFSKLTMYEKEYKDILYK
DYSEFTGNFYFYTKDWKTWQWYKMMGLDQEWYVEDKYFLRE
NLSQFVNDP
KYVDVVKGLKKFYMPVDYTRDIDFFNDETKMTYFTEDLGWNAYWYYLNMD
YAFFLNGKQFGLDKDRRGEYWIYNVQQILARYYQERLANGFGEIPEFFWY
KQIEYGYDPQLIYYNGIGYSYRKNYYDFYTYGKFEMYSQIQNFFSRVYKV
LETGFYKTADGQVFDLHKPEAIKIVGNYLQGNADTFDKYFFNYYYLLAHM
YFADVDYNDMEVFPNVFLNFETMLRDPFFYTFYKKFTDVFYTFKYYLKPY
TQKDLFYEGITIKDVSVSKLVTYYDIVDFDVTNLLNDKMTFVDGQYIWDK
ALLARQARLNHKPFNFEFTIDSDKVQKGVVRVFLGPKFDEYGRVIPLDYN
RKNFVQIDSFVYPFIAGTNTIKRSSKEFSWTAEDRITYTELYKYVMLASE
GKYDFPLDISEPHNAFPDRLVLPKGWEQGMPMQFYFFVSPFAETYEQFSN
FDYTYSSGVGSGTRFVDTKPFGYPFDRQIDESDFFVPNGFFKDVKVYYVD
TFAKYFEKKYTQFGTFDYSIEY
Original MKLTLVILALVACVTAFSVPTQKVKIADKNFLEKQKFLFEIVHRIDEPLM
FEEWIKMGQKLITDKAQYETFDFYMEKLWESYKLGALLPKGEFFGALVKT
HHKQAYGLFNFFYYAKDWETFVRNVAWARIHVNEGMFVYALTLAVIHKPE
FEGLILPQIYEIFPQYFFNSKFVYAAEKFDYEVFSKLTMYEKEYKDILYK
DYSEFTGNFYFYTKDWKTWQWYKMMGLDQEWYVEDKYFLRENLSQFVNDP
KYVDVVKGLKKFYMPVDYTRDIDFFNDETKMTYFTEDLGWNAYWYYLNMD
YAFFLNGKQFGLDKDRRGEYWIYNVQQILARYYQERLANGFGEIPEFFWY
KQIEYGYDPQLIYYNGIGYSYRKNYYDFYTYGKFEMYSQIQNFFSRVYKV
LETGFYKTADGQVFDLHKPEAIKIVGNYLQGNADTFDKYFFNYYYLLAHM
YFADVDYNDMEVFPNVFLNFETMLRDPFFYTFYKKFTDVFYTFKYYLKPY
TQKDLFYEGITIKDVSVSKLVTYYDIVDFDVTNLLNDKMTFVDGQYIWDK
ALLARQARLNHKPFNFEFTIDSDKVQKGVVRVFLGPKFDEYGRVIPLDYN
RKNFVQIDSFVYPFIAGTNTIKRSSKEFSWTAEDRITYTELYKYVMLASE
GKYDFPLDISEPHNAFPDRLVLPKGWEQGMPMQFYFFVSPFAETYEQFSN
FDYTYSSGVGSGTRFVDTKPFGYPFDRQIDESDFFVPNGFFKDVKVYYVD
TFAKYFEKKYTQFGTFDYSIEY
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11