Signal Peptide Database - Viruses

 Entry Details
ID   1185
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P03621    (Created: 1986-07-21 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   COATB_BPPF1
Protein Name   Coat protein B
Gene   VIII
Organism Scientific   Pseudomonas phage Pf1
Organism Common   Bacteriophage Pf1
Lineage   Viruses
  ssDNA viruses
    Inoviridae
      Inovirus
Protein Length [aa]   82
Protein Mass [Da]   8377
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   36
chain   Coat protein B      37   82
transmembrane region         56   78
topological domain   Extracellular   potential   37   55
topological domain   Cytoplasmic   potential   79   82
helix         38   41
helix         48   76
turn         79   81
SP Length   36
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKAMKQRIAKFSPVASFRNLCIAGSVTAATSLPAFA
Sequence MKAMKQRIAKFSPVASFRNLCIAGSVTAATSLPAFAGVIDTSAVESAITD
GQGDMKAIGGYIVGALVILAVAGLIY
SMLRKA
Original MKAMKQRIAKFSPVASFRNLCIAGSVTAATSLPAFAGVIDTSAVESAITD
GQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11