Signal Peptide Database - Viruses

 Entry Details
ID   1292
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P03394    (Created: 1986-07-21 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ENV_FRSFL
Protein Name   Glycoprotein 55
Gene   env
Organism Scientific   Friend spleen focus-forming virus (strain Lilly-Steeves)
Organism Common   FSFFV
Lineage   Viruses
  Retro-transcribing viruses
    Retroviridae
      Orthoretrovirinae
        Gammaretrovirus
Protein Length [aa]   409
Protein Mass [Da]   44700
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   32
chain   Glycoprotein 55      33   409
transmembrane region      potential   385   405
topological domain   Extracellular   potential   33   384
topological domain   Cytoplasmic   potential   406   409
glycosylation site   N-linked (GlcNAc...)   potential   43   43
glycosylation site   N-linked (GlcNAc...)   potential   58   58
glycosylation site   N-linked (GlcNAc...)   potential   296   296
glycosylation site   N-linked (GlcNAc...)   potential   328   328
glycosylation site   N-linked (GlcNAc...)   potential   377   377
compositionally biased region   Pro-rich      229   278
SP Length   32
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MEGPASSKPLKDKTNPWGPLIILGILIRAGVS
Sequence MEGPASSKPLKDKTNPWGPLIILGILIRAGVSVQLDSPHQVSNVTWRVTN
LMTGQTA
NATSLLGTMTEAFPKLYFDLCDLMGDDWDETGLGCRTPGGRKR
ARTFDFYVCPGHTVPTGCGGPREGYCGKWGCETTGQAYWKPSSSWDLISL
KRGNTPKDQGPCYDSSVSSGVLGATPGGRCNPLVLEFTDAGRKASWDAPK
VWGLRLYRSTGTDPVTRFSLTRQVLDIG
PRVPIGSNPVTTDQLPLSRPVQ
TMPPRPLQPPPPGAASIVPETAPPPQQP
GAGDRLLNLVDGAYQALNLTNP
DKIQECWLCLVSGPPYYEGVVVLGTYF
NHTIALKEKCCFYADHTGLVRDS
MAKLRKRLTQRQKLFESSRGWFEGSS
NRSPWFTTLISAIMGSLIILLLLL
ILLIW
TLYS
Original MEGPASSKPLKDKTNPWGPLIILGILIRAGVSVQLDSPHQVSNVTWRVTN
LMTGQTANATSLLGTMTEAFPKLYFDLCDLMGDDWDETGLGCRTPGGRKR
ARTFDFYVCPGHTVPTGCGGPREGYCGKWGCETTGQAYWKPSSSWDLISL
KRGNTPKDQGPCYDSSVSSGVLGATPGGRCNPLVLEFTDAGRKASWDAPK
VWGLRLYRSTGTDPVTRFSLTRQVLDIGPRVPIGSNPVTTDQLPLSRPVQ
TMPPRPLQPPPPGAASIVPETAPPPQQPGAGDRLLNLVDGAYQALNLTNP
DKIQECWLCLVSGPPYYEGVVVLGTYFNHTIALKEKCCFYADHTGLVRDS
MAKLRKRLTQRQKLFESSRGWFEGSSNRSPWFTTLISAIMGSLIILLLLL
ILLIWTLYS
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11