Signal Peptide Database - Viruses

 Entry Details
ID   249
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P68981    (Created: 2005-02-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   E3GL_ADE35
Protein Name   Early E3 18.5 kDa glycoprotein
Gene  
Organism Scientific   Human adenovirus B serotype 35
Organism Common   HAdV-35
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Adenoviridae
      Mastadenovirus
Protein Length [aa]   166
Protein Mass [Da]   18576
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   19
chain   Early E3 18.5 kDa glycoprotein      20   166
disulfide bond      by similarity   32   50
disulfide bond      by similarity   44   106
transmembrane region      potential   132   152
topological domain   Lumenal   potential   20   131
topological domain   Cytoplasmic   potential   153   166
glycosylation site   N-linked (GlcNAc...)   potential   31   31
glycosylation site   N-linked (GlcNAc...)   potential   63   63
glycosylation site   N-linked (GlcNAc...)   potential   67   67
glycosylation site   N-linked (GlcNAc...)   potential   97   97
short sequence motif   Di-lysine motif   by similarity   162   166
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MGPILVLLVLLSLLEPGSA
Sequence MGPILVLLVLLSLLEPGSANYDPCLDFDPENCTLTFAPDTSRICGVLIKC
GWECRSVEITHN
NKTWNNTLSTTWEPGVPEWYTVSVRGPDGSIRISNNTF
IFSEMCDLAMFMSKQYSLWPPSKDNIVTFSI
AYCLCACLLTALLCVCIHL
LV
TTRIKNANNKEKMP
Original MGPILVLLVLLSLLEPGSANYDPCLDFDPENCTLTFAPDTSRICGVLIKC
GWECRSVEITHNNKTWNNTLSTTWEPGVPEWYTVSVRGPDGSIRISNNTF
IFSEMCDLAMFMSKQYSLWPPSKDNIVTFSIAYCLCACLLTALLCVCIHL
LVTTRIKNANNKEKMP
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11