Signal Peptide Database - Viruses

 Entry Details
ID   269
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P31872    (Created: 1993-07-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ENV_HV1W1
Protein Name   Envelope glycoprotein gp160
Gene   env
Organism Scientific   Human immunodeficiency virus type 1 (isolate WMJ1 group M subtype B)
Organism Common   HIV-1
Lineage   Viruses
  Retro-transcribing viruses
    Retroviridae
      Orthoretrovirinae
        Lentivirus
          Primate lentivirus group
Protein Length [aa]   856
Protein Mass [Da]   97526
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   31
chain   Envelope glycoprotein gp160      32   856
chain   Surface protein   by similarity   32   510
chain   Transmembrane protein   by similarity   511   856
disulfide bond      by similarity   53   73
disulfide bond      by similarity   118   205
disulfide bond      by similarity   125   196
disulfide bond      by similarity   130   152
disulfide bond      by similarity   218   247
disulfide bond      by similarity   228   239
disulfide bond      by similarity   296   330
disulfide bond      by similarity   376   444
disulfide bond      by similarity   383   417
transmembrane region      potential   685   705
topological domain   Extracellular   potential   33   684
topological domain   Cytoplasmic   potential   706   856
region of interest   V1      130   151
region of interest   V2      152   196
region of interest   V3      296   329
region of interest   V4      383   417
region of interest   V5      460   470
region of interest   Fusion peptide   potential   511   531
region of interest   Immunosuppression   by similarity   576   592
region of interest   Involved in GalCer binding   by similarity   662   667
glycosylation site   N-linked (GlcNAc...)   potential   87   87
glycosylation site   N-linked (GlcNAc...)   potential   134   134
glycosylation site   N-linked (GlcNAc...)   potential   140   140
glycosylation site   N-linked (GlcNAc...)   potential   151   151
glycosylation site   N-linked (GlcNAc...)   potential   155   155
glycosylation site   N-linked (GlcNAc...)   potential   183   183
glycosylation site   N-linked (GlcNAc...)   potential   197   197
glycosylation site   N-linked (GlcNAc...)   potential   234   234
glycosylation site   N-linked (GlcNAc...)   potential   241   241
glycosylation site   N-linked (GlcNAc...)   potential   262   262
glycosylation site   N-linked (GlcNAc...)   potential   276   276
glycosylation site   N-linked (GlcNAc...)   potential   289   289
glycosylation site   N-linked (GlcNAc...)   potential   295   295
glycosylation site   N-linked (GlcNAc...)   potential   331   331
glycosylation site   N-linked (GlcNAc...)   potential   338   338
glycosylation site   N-linked (GlcNAc...)   potential   354   354
glycosylation site   N-linked (GlcNAc...)   potential   360   360
glycosylation site   N-linked (GlcNAc...)   potential   390   390
glycosylation site   N-linked (GlcNAc...)   potential   394   394
glycosylation site   N-linked (GlcNAc...)   potential   404   404
glycosylation site   N-linked (GlcNAc...)   potential   447   447
glycosylation site   N-linked (GlcNAc...)   potential   459   459
glycosylation site   N-linked (GlcNAc...)   potential   611   611
glycosylation site   N-linked (GlcNAc...)   potential   616   616
glycosylation site   N-linked (GlcNAc...)   potential   625   625
glycosylation site   N-linked (GlcNAc...)   potential   637   637
helix         662   670
site   Cleavage; by host furin   by similarity   510   511
short sequence motif   YXXL motif; contains endocytosis signal   by similarity   712   715
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   764   764
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   837   837
coiled-coil region      potential   542   592
coiled-coil region      potential   633   667
SP Length   31
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MRVKGIRRNCQHLWIWGTMLFGMWMICSAVE
Sequence MRVKGIRRNCQHLWIWGTMLFGMWMICSAVEQLWVTVYYGVPVWKEATTT
LFCASDAKAYSTEAHKVWATHACVPTNPNPQEVVLE
NVTENFNMWKNNMV
EQMHEDIISLWDQSLKPCVKLTPLCVTLN
CIDKNITDWENKTIIGGGEVK
NCSFNITTSIRDKVHKEYALFYKLDVVPIKSNNDSSTYTRYRLIHCNTSV
ITQACSKVSFEPIPIHYCAPAGFAILKCNDKKF
NGTGPCTNVSTVQCTHG
IRPVVSTQLLL
NGSLAEEEIVIRSENFTDNAKTIIVHLNESVEINCTRPN
NNVRRRHIHIGPGRAFYTGEIRGNIRQAH
CNISRAKWNNTLKQIVEKLRE
QFK
NKTIVFNHSSGGDPEIVTHSFNCGGEFFYCDSTQLFNSTWNVTGIST
EGN
NNTEENGDTITLPCRIKQIINMWQGVGKAMYAPPIGGQIRCSSNITG
LLLTRDGG
NSSSREEIFRPGGGNMRDNWRSELYKYKVVKIEPLGVAPTKA
KRRVVQREK
RAVGAIGAMFLGFLGAAGSTMGAASLTLTVQARQLLSGIVQ
QQNNLLRAIEAQQHLLQLTVWGIKQLQARVLAVERYLRDQQL
LGIWGCSG
KLICTTTVPW
NASWSNKSMDQIWNNMTWMEWEREIDNYTSLIYNLIEESQ
NQQEKNEQELLELDKWA
SLWNWFSITNWLWYIKIFIMIVGGLVGLRIVFS
VLSIV
NRVRQGYSPLSFQTHLPTPRGPDRPEGTEEEGGERDRDRSVRLVH
GFLALIWDDLRSL
CLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLL
QYWSKELKNSAVGLLNAIAIAVAEGTDRVIEVVQRI
CRAIIHIPRRIRQG
LERALL
Original MRVKGIRRNCQHLWIWGTMLFGMWMICSAVEQLWVTVYYGVPVWKEATTT
LFCASDAKAYSTEAHKVWATHACVPTNPNPQEVVLENVTENFNMWKNNMV
EQMHEDIISLWDQSLKPCVKLTPLCVTLNCIDKNITDWENKTIIGGGEVK
NCSFNITTSIRDKVHKEYALFYKLDVVPIKSNNDSSTYTRYRLIHCNTSV
ITQACSKVSFEPIPIHYCAPAGFAILKCNDKKFNGTGPCTNVSTVQCTHG
IRPVVSTQLLLNGSLAEEEIVIRSENFTDNAKTIIVHLNESVEINCTRPN
NNVRRRHIHIGPGRAFYTGEIRGNIRQAHCNISRAKWNNTLKQIVEKLRE
QFKNKTIVFNHSSGGDPEIVTHSFNCGGEFFYCDSTQLFNSTWNVTGIST
EGNNNTEENGDTITLPCRIKQIINMWQGVGKAMYAPPIGGQIRCSSNITG
LLLTRDGGNSSSREEIFRPGGGNMRDNWRSELYKYKVVKIEPLGVAPTKA
KRRVVQREKRAVGAIGAMFLGFLGAAGSTMGAASLTLTVQARQLLSGIVQ
QQNNLLRAIEAQQHLLQLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSG
KLICTTTVPWNASWSNKSMDQIWNNMTWMEWEREIDNYTSLIYNLIEESQ
NQQEKNEQELLELDKWASLWNWFSITNWLWYIKIFIMIVGGLVGLRIVFS
VLSIVNRVRQGYSPLSFQTHLPTPRGPDRPEGTEEEGGERDRDRSVRLVH
GFLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLL
QYWSKELKNSAVGLLNAIAIAVAEGTDRVIEVVQRICRAIIHIPRRIRQG
LERALL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11