Signal Peptide Database - Viruses

 Entry Details
ID   270
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P08360    (Created: 1988-08-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ENV_MLVCB
Protein Name   Envelope glycoprotein
Gene   env
Organism Scientific   Cas-Br-E murine leukemia virus
Organism Common  
Lineage   Viruses
  Retro-transcribing viruses
    Retroviridae
      Orthoretrovirinae
        Gammaretrovirus
          Murine leukemia virus
Protein Length [aa]   661
Protein Mass [Da]   72625
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   33
chain   Envelope glycoprotein      34   661
chain   Surface protein   by similarity   34   465
chain   Transmembrane protein   by similarity   466   645
disulfide bond      by similarity   77   129
disulfide bond      by similarity   103   118
disulfide bond      by similarity   104   114
disulfide bond      by similarity   152   172
disulfide bond      by similarity   164   177
disulfide bond      by similarity   209   215
disulfide bond   Interchain (between SU and TM chains, or C-335 with C-559); alternate      332   559
disulfide bond   Alternate      332   335
disulfide bond      by similarity   362   416
disulfide bond      by similarity   381   393
disulfide bond      by similarity   423   436
disulfide bond      by similarity   551   558
transmembrane region      potential   607   627
topological domain   Extracellular   potential   1   606
topological domain   Cytoplasmic   potential   628   661
region of interest   Fusion peptide   by similarity   468   488
region of interest   Immunosuppression   by similarity   534   550
glycosylation site   N-linked (GlcNAc...)   by similarity   43   43
glycosylation site   N-linked (GlcNAc...)   by similarity   199   199
glycosylation site   N-linked (GlcNAc...)   by similarity   322   322
glycosylation site   N-linked (GlcNAc...)   potential   361   361
glycosylation site   N-linked (GlcNAc...)   potential   394   394
glycosylation site   N-linked (GlcNAc...)   potential   430   430
site   Cleavage; by host   by similarity   465   466
site   Cleavage; by viral protease      645   646
metal ion-binding site   Zinc   by similarity   86   86
metal ion-binding site   Zinc   by similarity   117   117
compositionally biased region   Poly-Pro      288   291
short sequence motif   CXXC      332   335
short sequence motif   CX6CC      551   559
short sequence motif   YXXL motif; contains endocytosis signal   by similarity   651   654
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   626   626
peptide   R-peptide. /FTId=PRO_0000040750      646   661
coiled-coil region      potential   496   545
coiled-coil region      potential   555   591
SP Length   33
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MEGPAFSKSPKDKTIERAFLGVLGILFVTGGLA
Sequence MEGPAFSKSPKDKTIERAFLGVLGILFVTGGLASRDNPHQVYNITWEVTN
GEQDTVWAVTGNHPLWTWWPDLTPDLCMLALHGPT
HWGLDNHPPYSSPPG
PPCCSGDAGAVSGCAR
DCDEPLTSYSPRCNTAWNRLKLARVTHAPKEGFY
ICPGSHRPRWARSCGGLDAYYCASWGCETTGRAAWNPTSSWDYITVSN
NL
TSSQATKACKNNGWCNPLVIRFTGPGKRATSWTTGHFWGLRLYISGHDPG
LTFGIRLKVTDLGPRVPIGPNPVLSDQRPPSRPVPAR
PPPPSASPSTPTI
PPQQGTGDRLLNLVQGAYLTL
NMTDPTRTQECWLCLVSEPPYYEGVAVLR
EYTSHETAPA
NCSSGSQHKLTLSEVTGQGRCLGTVPKTHQALCNRTEPTV
SGSNYLVAPEGTLWACSTGLTPCLSTTVL
NLTTDYCVLVELWPKVTYHSP
DYVYTQFEPGARFR
REPVSLTLALLPEGLTMGGIAAGVGTGTTALVATQQ
FQQLQAAMHNDLKEVEKSITNLEKSLTSLSEVVLQNRRGLDLLFL
KEGGL
CAALKEECCFYADHTGLVRDSMAKLRERLNQRQKLFESGQGWFEGLFNRS
PWFTTL
ISTIMGPLIVLLLILLFGPCILNRLVQFVKDRISVVQALVLTQQ
YHQLKPIEYEP
Original MEGPAFSKSPKDKTIERAFLGVLGILFVTGGLASRDNPHQVYNITWEVTN
GEQDTVWAVTGNHPLWTWWPDLTPDLCMLALHGPTHWGLDNHPPYSSPPG
PPCCSGDAGAVSGCARDCDEPLTSYSPRCNTAWNRLKLARVTHAPKEGFY
ICPGSHRPRWARSCGGLDAYYCASWGCETTGRAAWNPTSSWDYITVSNNL
TSSQATKACKNNGWCNPLVIRFTGPGKRATSWTTGHFWGLRLYISGHDPG
LTFGIRLKVTDLGPRVPIGPNPVLSDQRPPSRPVPARPPPPSASPSTPTI
PPQQGTGDRLLNLVQGAYLTLNMTDPTRTQECWLCLVSEPPYYEGVAVLR
EYTSHETAPANCSSGSQHKLTLSEVTGQGRCLGTVPKTHQALCNRTEPTV
SGSNYLVAPEGTLWACSTGLTPCLSTTVLNLTTDYCVLVELWPKVTYHSP
DYVYTQFEPGARFRREPVSLTLALLPEGLTMGGIAAGVGTGTTALVATQQ
FQQLQAAMHNDLKEVEKSITNLEKSLTSLSEVVLQNRRGLDLLFLKEGGL
CAALKEECCFYADHTGLVRDSMAKLRERLNQRQKLFESGQGWFEGLFNRS
PWFTTLISTIMGPLIVLLLILLFGPCILNRLVQFVKDRISVVQALVLTQQ
YHQLKPIEYEP
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11