Signal Peptide Database - Viruses

 Entry Details
ID   271
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P05884    (Created: 1988-11-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ENV_SIVMK
Protein Name   Envelope glycoprotein gp160
Gene   env
Organism Scientific   Simian immunodeficiency virus (isolate K6W)
Organism Common   SIV-mac
Lineage   Viruses
  Retro-transcribing viruses
    Retroviridae
      Orthoretrovirinae
        Lentivirus
          Primate lentivirus group
Protein Length [aa]   881
Protein Mass [Da]   101186
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   19
chain   Envelope glycoprotein gp160      20   881
chain   Surface protein   by similarity   20   527
chain   Transmembrane protein   by similarity   528   881
disulfide bond      by similarity   44   57
disulfide bond      by similarity   101   222
disulfide bond      by similarity   108   213
disulfide bond      by similarity   113   170
disulfide bond      by similarity   235   265
disulfide bond      by similarity   245   257
disulfide bond      by similarity   313   346
disulfide bond      by similarity   397   461
disulfide bond      by similarity   404   434
transmembrane region      potential   697   717
topological domain   Extracellular   potential   20   696
topological domain   Cytoplasmic   potential   718   881
region of interest   V1      113   169
region of interest   V2      170   213
region of interest   V3      313   345
region of interest   V4      404   434
region of interest   V5      477   484
region of interest   Fusion peptide   potential   528   548
region of interest   Immunosuppression   by similarity   591   607
glycosylation site   N-linked (GlcNAc...)   potential   37   37
glycosylation site   N-linked (GlcNAc...)   potential   70   70
glycosylation site   N-linked (GlcNAc...)   potential   114   114
glycosylation site   N-linked (GlcNAc...)   potential   148   148
glycosylation site   N-linked (GlcNAc...)   potential   158   158
glycosylation site   N-linked (GlcNAc...)   potential   186   186
glycosylation site   N-linked (GlcNAc...)   potential   200   200
glycosylation site   N-linked (GlcNAc...)   potential   204   204
glycosylation site   N-linked (GlcNAc...)   potential   214   214
glycosylation site   N-linked (GlcNAc...)   potential   246   246
glycosylation site   N-linked (GlcNAc...)   potential   249   249
glycosylation site   N-linked (GlcNAc...)   potential   280   280
glycosylation site   N-linked (GlcNAc...)   potential   286   286
glycosylation site   N-linked (GlcNAc...)   potential   297   297
glycosylation site   N-linked (GlcNAc...)   potential   308   308
glycosylation site   N-linked (GlcNAc...)   potential   318   318
glycosylation site   N-linked (GlcNAc...)   potential   373   373
glycosylation site   N-linked (GlcNAc...)   potential   379   379
glycosylation site   N-linked (GlcNAc...)   potential   462   462
glycosylation site   N-linked (GlcNAc...)   potential   478   478
glycosylation site   N-linked (GlcNAc...)   potential   627   627
glycosylation site   N-linked (GlcNAc...)   potential   636   636
glycosylation site   N-linked (GlcNAc...)   potential   652   652
strand         208   212
strand         247   249
strand         271   279
strand         300   304
strand         309   314
strand         345   350
strand         365   367
strand         392   399
strand         401   405
strand         421   423
strand         438   440
strand         443   446
strand         467   470
strand         476   478
strand         496   498
helix         187   194
helix         268   270
helix         352   362
helix         488   495
site   Cleavage; by host furin   potential   527   528
site   In-frame UAG termination codon      736   736
compositionally biased region   Poly-Gln      565   569
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   789   789
turn         315   317
coiled-coil region      potential   557   607
coiled-coil region      potential   644   678
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MGCLGNQLLIAILLLSVYG
Sequence MGCLGNQLLIAILLLSVYGIYCTQYVTVFYGVPAWRNATIPLFCATKNRD
TWGTTQCLPDNGDYSELAL
NVTESFDAWENTVTEQAIEDVWQLFETSIKP
CVKLSPLCITMR
CNKSETDRWGLTKSSTTITTAAPTSAPVSEKIDMVNET
SSCIAQN
NCTGLEQEQMISCKFTMTGLKRDKTKEYNETWYSTDLVCEQGN
STDNESRCYMNHCNTSVIQESCDKHYWDTIRFRYCAPPGYALLRCNDTNY
SGFMPKCSKVVVSSCTR
MMETQTSTWFGFNGTRAENRTYIYWHGRDNRTI
ISLN
KYYNLTMKCRRPGNKTVLPVTIMSGLVFHSQPLTDRPKQAWCWFGG
KWKDAIKEVKQTIVKHPRYTGTNNTDKINLTAPGGGDPEVTFMWTNCRGE
FLYCKMNWFLNWVEDRDVTTQRPKERHRRNYVPCHIRQIINTWHKVGKNV
YLPPREGDLTC
NSTVTSLIANIDWTDGNQTSITMSAEVAELYRLELGDYK
LVEITPIGLAPTDVKRYTTGGTSRNK
RGVFVLGFLGFLATAGSAMGAASF
RLTAQS
RTLLAGIVQQQQQLLGVVKRQQELLRLTVWGTKNLQTRVTAIEK
YLEDQAQ
LNAWGCAFRQVCHTTVPWPNASLTPDWNNDTWQEWERKVDFLE
ENITALLEEAQIQQEKNMYELQKLNSWD
VFGNWFDLASWIKYIQYGIYVV
VGVILLRIVIYIVQMLA
KLRQGYRPVFSSPPSYFQXTHTQQDPALPTREG
KEGDGGEGGGNSSWPWQIEYIHFLIRQLIRLLTWLFSN
CRTLLSRAYQIL
QPILQRLSATLRRIREVLRTELTYLQYGWSYFHEAVQAGWRSATETLAGA
WGDLWETLRRGGRWILAIPRRIRQGLELTLL
Original MGCLGNQLLIAILLLSVYGIYCTQYVTVFYGVPAWRNATIPLFCATKNRD
TWGTTQCLPDNGDYSELALNVTESFDAWENTVTEQAIEDVWQLFETSIKP
CVKLSPLCITMRCNKSETDRWGLTKSSTTITTAAPTSAPVSEKIDMVNET
SSCIAQNNCTGLEQEQMISCKFTMTGLKRDKTKEYNETWYSTDLVCEQGN
STDNESRCYMNHCNTSVIQESCDKHYWDTIRFRYCAPPGYALLRCNDTNY
SGFMPKCSKVVVSSCTRMMETQTSTWFGFNGTRAENRTYIYWHGRDNRTI
ISLNKYYNLTMKCRRPGNKTVLPVTIMSGLVFHSQPLTDRPKQAWCWFGG
KWKDAIKEVKQTIVKHPRYTGTNNTDKINLTAPGGGDPEVTFMWTNCRGE
FLYCKMNWFLNWVEDRDVTTQRPKERHRRNYVPCHIRQIINTWHKVGKNV
YLPPREGDLTCNSTVTSLIANIDWTDGNQTSITMSAEVAELYRLELGDYK
LVEITPIGLAPTDVKRYTTGGTSRNKRGVFVLGFLGFLATAGSAMGAASF
RLTAQSRTLLAGIVQQQQQLLGVVKRQQELLRLTVWGTKNLQTRVTAIEK
YLEDQAQLNAWGCAFRQVCHTTVPWPNASLTPDWNNDTWQEWERKVDFLE
ENITALLEEAQIQQEKNMYELQKLNSWDVFGNWFDLASWIKYIQYGIYVV
VGVILLRIVIYIVQMLAKLRQGYRPVFSSPPSYFQXTHTQQDPALPTREG
KEGDGGEGGGNSSWPWQIEYIHFLIRQLIRLLTWLFSNCRTLLSRAYQIL
QPILQRLSATLRRIREVLRTELTYLQYGWSYFHEAVQAGWRSATETLAGA
WGDLWETLRRGGRWILAIPRRIRQGLELTLL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11