Signal Peptide Database - Viruses

 Entry Details
ID   328
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P04855    (Created: 1987-08-13 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   FUS_SENDZ
Protein Name   Fusion glycoprotein F0
Gene   F
Organism Scientific   Sendai virus (strain Z)
Organism Common   SeV
Lineage   Viruses
  ssRNA negative-strand viruses
    Mononegavirales
      Paramyxoviridae
        Paramyxovirinae
          Respirovirus
Protein Length [aa]   565
Protein Mass [Da]   61644
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   25
chain   Fusion glycoprotein F0      26   565
chain   Fusion glycoprotein F2      26   116
chain   Fusion glycoprotein F1      117   565
disulfide bond   Interchain (between F2 and F1 chains)      70   199
disulfide bond         338   347
disulfide bond         362   370
disulfide bond      by similarity   394   399
disulfide bond      by similarity   401   424
transmembrane region         501   521
topological domain   Extracellular      26   500
topological domain   Cytoplasmic      522   565
domain   Leucine-zipper   potential   278   306
region of interest   Fusion peptide      117   141
glycosylation site   N-linked (GlcNAc...)      104   104
glycosylation site   N-linked (GlcNAc...)      245   245
glycosylation site   N-linked (GlcNAc...)      449   449
sequence variant         0   0
sequence variant   (in strain: Mutant BY-4, Mutant BY-5, Mutant BY-13)      0   0
sequence variant   (in strain: Mutant F1-R, Mutant F1-R / T-5 revertant, Mutant ts-f1)      0   0
sequence variant   (in strain: wild-type, Mutant F1- R, Mutant F1-R / T-5 revertant, Mutant ts-f1)      0   0
sequence variant   (in strain: Mutant BY-4, Mutant BY-13)      0   0
sequence variant   (in strain: Mutant KD-22M)      0   0
sequence variant   (in strain: Mutant KD-32, KD- 32M)      0   0
sequence variant   (in strain: Mutant KD-32, KD- 32M)      0   0
sequence variant   (in strain: Mutant KD-61)      0   0
sequence variant   (in strain: Mutant KD-61)      0   0
sequence variant   (in strain: Mutant F1-R, Mutant F1-R / T-5 revertant, Mutant ts-f1)      0   0
sequence variant   (in strain: Mutant KD-51, Mutant KD-51M)      0   0
sequence variant   (in strain: Mutant KD-22)      0   0
sequence variant   (in strain: wild-type, Mutant F1- R, Mutant F1-R / T-5 revertant, Mutant ts-f1)      0   0
sequence variant   (in strain: Mutant KD-51, Mutant KD-51M)      0   0
sequence variant   (in strain: Mutant KD-52M)      0   0
sequence variant   (in strain: Mutant KD-61)      0   0
sequence variant   (in strain: Mutant KD-52M)      0   0
sequence variant   (in strain: Mutant F1-R / T-5 revertant)      0   0
sequence variant   (in strain: Mutant KD-21, Mutant KD-62)      0   0
sequence variant   (in Mutant KD-21, Mutant KD- 52)      0   0
sequence variant   (in strain: Mutant KD-41)      0   0
sequence variant   (in strain: Mutant F1-R, Mutant F1-R / T-5 revertant, Mutant ts-f1)      0   0
sequence variant   (in strain: Mutant KD-32)      0   0
sequence variant   (in strain: Mutant KD-22M, Mutant KD-32M)      0   0
sequence variant   (in strain: Mutant KD-62)      0   0
sequence variant   (in strain: Mutant BF-41, Mutant BF-53, Mutant BF-82, Mutant BF-132)      0   0
sequence variant   (in strain: Mutant KD-51, Mutant KD-51M)      0   0
sequence variant   (in strain: Mutant KD-51M)      0   0
sequence variant   (in strain: Mutant F1-R, Mutant F1-R / T-5 revertant, Mutant ts-f1)      0   0
sequence variant   (in strain: Mutant KD-11, Mutant KD-11M)      0   0
sequence variant   (in strain: Mutant KD-31, Mutant KD-61)      0   0
sequence variant   (in strain: Mutant KD-52M)      0   0
sequence variant   (in strain: Mutant F1-R, Mutant ts-f1)      0   0
sequence variant   (in strain: Mutant KD-22 in Mutant KD-22M)      0   0
site   Cleavage; by arginine-specific endoprotease      116   117
mutagenesis site   Loss of glycosylation      0   0
mutagenesis site   Inhibits transport of F and HN to the cell surface      0   0
mutagenesis site   Inhibits transport of F and HN to the cell surface      0   0
mutagenesis site   Inhibits transport of F and HN to the cell surface      0   0
mutagenesis site   Inhibits transport of F and HN to the cell surface      0   0
mutagenesis site   Inhibits transport of F and HN to the cell surface      0   0
mutagenesis site   Inhibits transport of F and HN to the cell surface      0   0
mutagenesis site   Inhibits transport of F and HN to the cell surface      0   0
mutagenesis site   Inhibits transport of F and HN to the cell surface      0   0
mutagenesis site   Loss of glycosylation, cell surface transport and F0 cleavage      0   0
mutagenesis site   Inhibits transport of F and HN to the cell surface      0   0
mutagenesis site   Loss of glycosylation, enhances cell fusion activity      0   0
mutagenesis site   Inhibits transport of F and HN to the cell surface      0   0
coiled-coil region      potential   142   170
coiled-coil region      potential   466   491
SP Length   25
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MTAYIQRSQCISTSLLVVLTTLVSC
Sequence MTAYIQRSQCISTSLLVVLTTLVSCQIPRDRLSNIGVIVDEGKSLKIAGS
HESRYIVLSLVPGVDFENGCGTAQVIQYKSLLNRLLIPLRDALDLQEALI
TVT
NDTTQNAGAPQSRFFGAVIGTIALGVATSAQITAGIALAEAREAKRD
IALIKESMTKTHKSIELLQN
AVGEQILALKTLQDFVNDEIKPAISELGCE
TAALRLGIKLTQHYSELLTAFGSNFGTIGEKSLTLQALSSLYSA
NITEIM
TTIKTGQSNIYDVIYTEQIKGTVIDVD
LERYMVTLSVKIPILSEVPGVLI
HKASSI
SYNIDGEEWYVTVPSHILSRASFLGGADITDCVESRLTYICPRD
PAQLIPDSQQKCILGDTTRCPVTKVVDSLIPKFAFVNGGVVANCIASTCT
CGTGRRPISQDRSKGVVFLTHDNCGLIGVNGVELYANRRGHDATWGVQ
NL
TVGPAIAIRPIDISL
NLADATNFLQDSKAELEKARKILSEVGRWYNSRET
VITIIVVMVVILVVIIVIIIVLYRLRRSMLMGNPDDRIPRDTYTLEPKIR
HMYTNGGFDAMAEKR
Original MTAYIQRSQCISTSLLVVLTTLVSCQIPRDRLSNIGVIVDEGKSLKIAGS
HESRYIVLSLVPGVDFENGCGTAQVIQYKSLLNRLLIPLRDALDLQEALI
TVTNDTTQNAGAPQSRFFGAVIGTIALGVATSAQITAGIALAEAREAKRD
IALIKESMTKTHKSIELLQNAVGEQILALKTLQDFVNDEIKPAISELGCE
TAALRLGIKLTQHYSELLTAFGSNFGTIGEKSLTLQALSSLYSANITEIM
TTIKTGQSNIYDVIYTEQIKGTVIDVDLERYMVTLSVKIPILSEVPGVLI
HKASSISYNIDGEEWYVTVPSHILSRASFLGGADITDCVESRLTYICPRD
PAQLIPDSQQKCILGDTTRCPVTKVVDSLIPKFAFVNGGVVANCIASTCT
CGTGRRPISQDRSKGVVFLTHDNCGLIGVNGVELYANRRGHDATWGVQNL
TVGPAIAIRPIDISLNLADATNFLQDSKAELEKARKILSEVGRWYNSRET
VITIIVVMVVILVVIIVIIIVLYRLRRSMLMGNPDDRIPRDTYTLEPKIR
HMYTNGGFDAMAEKR
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11