Signal Peptide Database - Viruses

 Entry Details
ID   374
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q6RZT5    (Created: 2004-12-07 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   GRFA_RABPU
Protein Name   Growth factor
Gene   RPXV006
Organism Scientific   Rabbitpox virus (strain Utrecht)
Organism Common   RPV
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Poxviridae
      Chordopoxvirinae
        Orthopoxvirus
Protein Length [aa]   138
Protein Mass [Da]   15336
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   19
chain   Growth factor      20   138
disulfide bond      by similarity   45   58
disulfide bond      by similarity   53   69
disulfide bond      by similarity   71   80
domain   EGF-like      41   81
glycosylation site   N-linked (GlcNAc...)   potential   34   34
glycosylation site   N-linked (GlcNAc...)   potential   95   95
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MSMKYLMLLFAAMIIRSFA
Sequence MSMKYLMLLFAAMIIRSFADSGNAIETTLPEITNATTDIPAIRLCGPEGD
GYCLHGDCIHARDIDGMYCRCSHGYTGIRCQ
HVVLVDYQRSEKPNTTTSY
IPSPGIVLVLVGIIMCCLLSVYRFTRRTKLPIQDMVVP
Original MSMKYLMLLFAAMIIRSFADSGNAIETTLPEITNATTDIPAIRLCGPEGD
GYCLHGDCIHARDIDGMYCRCSHGYTGIRCQHVVLVDYQRSEKPNTTTSY
IPSPGIVLVLVGIIMCCLLSVYRFTRRTKLPIQDMVVP
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11