Signal Peptide Database - Viruses

 Entry Details
ID   392
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q6DQ15    (Created: 2007-11-13 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   HEMA_I02A7
Protein Name   Hemagglutinin
Gene   HA
Organism Scientific   Influenza A virus (strain A/Teal/China/2978.1/2002 H5N1 genotype W)
Organism Common  
Lineage   Viruses
  ssRNA negative-strand viruses
    Orthomyxoviridae
      Influenzavirus A
Protein Length [aa]   545
Protein Mass [Da]   61731
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   12
chain   Hemagglutinin HA1 chain      13   334
chain   Hemagglutinin HA2 chain      343   545
disulfide bond   Interchain (between HA1 and HA2 chains)   by similarity   16   479
disulfide bond      by similarity   54   286
disulfide bond      by similarity   67   79
disulfide bond      by similarity   102   147
disulfide bond      by similarity   290   314
disulfide bond      by similarity   486   490
topological domain   Extracellular   potential   13   545
glycosylation site   N-linked (GlcNAc...)   potential   22   22
glycosylation site   N-linked (GlcNAc...)   potential   23   23
glycosylation site   N-linked (GlcNAc...)   potential   35   35
glycosylation site   N-linked (GlcNAc...)   potential   177   177
glycosylation site   N-linked (GlcNAc...)   potential   298   298
glycosylation site   N-linked (GlcNAc...)   potential   496   496
site   Cleavage; by host   by similarity   342   343
propeptide   Connecting peptide      335   342
non-terminal residue         1   1
non-terminal residue         545   545
SP Length   12
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide VLLLAIVSLVKS
Sequence VLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHN
GKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFINVPEWSYIVERASPAND
LCYPGDFNDYEELKHLLSRINHFEKIQIFPKSSWPNHEASSGVSSACPYQ
GRSSFFRNVVWLIKKNSAYPTIKRSY
NNTNQEDLLVLWGIHHPNDAAEQT
KLYQNPTTYISVGTSTLNQRLVPKIATRSKVNGQSGRMEFFWTILKPNDA
INFESNGNFIAPEYAYKIVKKGDSAIMKSELEYGNCNTKCQTPMGAI
NSS
MPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQ
REIRRKKRGLFGAIAG
FIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDK
MNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTL
DFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVK
NGTYD
YPHYSEEARLNREEISGVKLESIGTYQILSIYSTVASSLALAIM
V
Original VLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHN
GKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFINVPEWSYIVERASPAND
LCYPGDFNDYEELKHLLSRINHFEKIQIFPKSSWPNHEASSGVSSACPYQ
GRSSFFRNVVWLIKKNSAYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQT
KLYQNPTTYISVGTSTLNQRLVPKIATRSKVNGQSGRMEFFWTILKPNDA
INFESNGNFIAPEYAYKIVKKGDSAIMKSELEYGNCNTKCQTPMGAINSS
MPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQREIRRKKRGLFGAIAG
FIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDK
MNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTL
DFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVKNGTYD
YPHYSEEARLNREEISGVKLESIGTYQILSIYSTVASSLALAIMV
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11