Signal Peptide Database - Viruses

 Entry Details
ID   393
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P16060    (Created: 1990-04-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   HEMA_I66A0
Protein Name   Hemagglutinin
Gene   HA
Organism Scientific   Influenza A virus (strain A/Turkey/Ontario/7732/1966 H5N9)
Organism Common  
Lineage   Viruses
  ssRNA negative-strand viruses
    Orthomyxoviridae
      Influenzavirus A
Protein Length [aa]   565
Protein Mass [Da]   63963
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   16
chain   Hemagglutinin HA1 chain      17   342
chain   Hemagglutinin HA2 chain      344   565
disulfide bond   Interchain (between HA1 and HA2 chains)   by similarity   20   480
disulfide bond      by similarity   58   290
disulfide bond      by similarity   71   83
disulfide bond      by similarity   106   151
disulfide bond      by similarity   294   318
disulfide bond      by similarity   487   491
transmembrane region      potential   529   549
topological domain   Extracellular   potential   17   528
topological domain   Cytoplasmic   potential   550   565
glycosylation site   N-linked (GlcNAc...)   potential   26   26
glycosylation site   N-linked (GlcNAc...)   potential   27   27
glycosylation site   N-linked (GlcNAc...)   potential   39   39
glycosylation site   N-linked (GlcNAc...)   potential   142   142
glycosylation site   N-linked (GlcNAc...)   potential   170   170
glycosylation site   N-linked (GlcNAc...)   potential   181   181
glycosylation site   N-linked (GlcNAc...)   potential   302   302
glycosylation site   N-linked (GlcNAc...)   potential   497   497
site   Cleavage; by host   by similarity   343   344
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   554   554
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   561   561
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   564   564
SP Length   16
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MERIVIALAIISVVKG
Sequence MERIVIALAIISVVKGDQICIGYHANNSTKQVDTIMEKNVTVTYAQDILE
KEHNGKLCSLKGVRPLILKDCSVAGWLLGNPMCDEFLNVPEWSYIVEKDN
PTNGLCYPGDFNDYEELKHLMSSTNHIEKIRIIPRNSWSEH
NASSGVSSS
CPYNGRSSFYRNVVWLIKK
NNSYPTIKRTYNNTNVEDLLILWGIHHPADA
AEQTRLYKNSNTYVSVGTSTLNQRSIPEIATRPKVNGQNGRIEFFWTILR
PNHAISFESNGNFIAPEYAYKIVKKGDSAIMRSELEYGNCDTKCQTPVGA
I
NSSMPFHNVHPLTIGECPKYVKSNKLVLATGPRNVPQRRKKRGLFGAKA
GFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTHKAIDGITNKVNSIID
KMNTQFEAVGKEFNNLERRIENLNKQMEDGFLDVWTYNAELLVLMENERT
LDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVR
NGTY
DYPQYSEESRLNREEIDGVKLESMGTYQ
ILSIYSTVASSLALAIMVAGLS
FWM
CSNGSLQCRICI
Original MERIVIALAIISVVKGDQICIGYHANNSTKQVDTIMEKNVTVTYAQDILE
KEHNGKLCSLKGVRPLILKDCSVAGWLLGNPMCDEFLNVPEWSYIVEKDN
PTNGLCYPGDFNDYEELKHLMSSTNHIEKIRIIPRNSWSEHNASSGVSSS
CPYNGRSSFYRNVVWLIKKNNSYPTIKRTYNNTNVEDLLILWGIHHPADA
AEQTRLYKNSNTYVSVGTSTLNQRSIPEIATRPKVNGQNGRIEFFWTILR
PNHAISFESNGNFIAPEYAYKIVKKGDSAIMRSELEYGNCDTKCQTPVGA
INSSMPFHNVHPLTIGECPKYVKSNKLVLATGPRNVPQRRKKRGLFGAKA
GFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTHKAIDGITNKVNSIID
KMNTQFEAVGKEFNNLERRIENLNKQMEDGFLDVWTYNAELLVLMENERT
LDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTY
DYPQYSEESRLNREEIDGVKLESMGTYQILSIYSTVASSLALAIMVAGLS
FWMCSNGSLQCRICI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11