Signal Peptide Database - Viruses

 Entry Details
ID   394
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P03446    (Created: 1986-07-21 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   HEMA_I76A2
Protein Name   Hemagglutinin
Gene   HA
Organism Scientific   Influenza A virus (strain A/Duck/Alberta/60/1976 H12N5)
Organism Common  
Lineage   Viruses
  ssRNA negative-strand viruses
    Orthomyxoviridae
      Influenzavirus A
Protein Length [aa]   564
Protein Mass [Da]   63713
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   17
chain   Hemagglutinin HA1 chain      18   341
chain   Hemagglutinin HA2 chain      343   564
disulfide bond   Interchain (between HA1 and HA2 chains)   by similarity   21   479
disulfide bond      by similarity   59   290
disulfide bond      by similarity   72   84
disulfide bond      by similarity   107   150
disulfide bond      by similarity   294   318
disulfide bond      by similarity   486   490
transmembrane region      potential   531   551
topological domain   Extracellular   potential   17   530
topological domain   Cytoplasmic   potential   552   564
glycosylation site   N-linked (GlcNAc...)   potential   27   27
glycosylation site   N-linked (GlcNAc...)   potential   28   28
glycosylation site   N-linked (GlcNAc...)   potential   140   140
glycosylation site   N-linked (GlcNAc...)   potential   151   151
glycosylation site   N-linked (GlcNAc...)   potential   152   152
glycosylation site   N-linked (GlcNAc...)   potential   222   222
glycosylation site   N-linked (GlcNAc...)   potential   302   302
glycosylation site   N-linked (GlcNAc...)   potential   309   309
glycosylation site   N-linked (GlcNAc...)   potential   496   496
glycosylation site   N-linked (GlcNAc...)   potential   523   523
site   Cleavage; by host   by similarity   342   343
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   553   553
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   560   560
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   563   563
SP Length   17
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MEKFIILSTVLAASFAY
Sequence MEKFIILSTVLAASFAYDKICIGYQTNNSTETVNTLSEQNVPVTQVEELV
HRGIDPILCGTELGSPLVLDDCSLEGLILGNPKCDLYLNGREWSYIVERP
KEMEGVCYPGSIENQEELRSLFSSIKKYERVKMFDFTKW
NVTYTGTSKAC
NNTSNQGSFYRSMRWLTLKSGQFPVQTDEYKNTRDSDIVFTWAIHHPPTS
DEQVKLYKNPDTLSSVTTVEI
NRSFKPNIGPRPLVRGQQGRMDYYWAVLK
PGQTVKIQTNGNLIAPEYGHLITGKSHGRILKNNLPMGQCVTECQLNEGV
M
NTSKPFQNTSKHYIGKCPKYIPSGSLKLAIGLRNVPQVQDRGLFGAIAG
FIEGGWPGLVAGWYGFQHQNAEGTGIAADRDSTQRAIDNMQNKLNNVIDK
MNKQFEVVNHEFSEVESRINMINSKIDDQITDIWAYNAELLVLLENQKTL
DEHDANVRNLHDRVRRVLRENAIDTGDGCFEILHKCDNNCMDTIR
NGTYN
HKEYEEESKIERQKVNGVKLEE
NSTYKILSIYSSVASSLVLLLMIIGGFI
F
GCQNGNVRCTFCI
Original MEKFIILSTVLAASFAYDKICIGYQTNNSTETVNTLSEQNVPVTQVEELV
HRGIDPILCGTELGSPLVLDDCSLEGLILGNPKCDLYLNGREWSYIVERP
KEMEGVCYPGSIENQEELRSLFSSIKKYERVKMFDFTKWNVTYTGTSKAC
NNTSNQGSFYRSMRWLTLKSGQFPVQTDEYKNTRDSDIVFTWAIHHPPTS
DEQVKLYKNPDTLSSVTTVEINRSFKPNIGPRPLVRGQQGRMDYYWAVLK
PGQTVKIQTNGNLIAPEYGHLITGKSHGRILKNNLPMGQCVTECQLNEGV
MNTSKPFQNTSKHYIGKCPKYIPSGSLKLAIGLRNVPQVQDRGLFGAIAG
FIEGGWPGLVAGWYGFQHQNAEGTGIAADRDSTQRAIDNMQNKLNNVIDK
MNKQFEVVNHEFSEVESRINMINSKIDDQITDIWAYNAELLVLLENQKTL
DEHDANVRNLHDRVRRVLRENAIDTGDGCFEILHKCDNNCMDTIRNGTYN
HKEYEEESKIERQKVNGVKLEENSTYKILSIYSSVASSLVLLLMIIGGFI
FGCQNGNVRCTFCI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11