Signal Peptide Database - Viruses

 Entry Details
ID   398
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P16561    (Created: 1990-08-01 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   HEMA_VACCT
Protein Name   Hemagglutinin
Gene   HA
Organism Scientific   Vaccinia virus (strain Tian Tan)
Organism Common   VACV
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Poxviridae
      Chordopoxvirinae
        Orthopoxvirus
Protein Length [aa]   315
Protein Mass [Da]   34758
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   16
chain   Hemagglutinin      17   315
disulfide bond      potential   34   103
transmembrane region      potential   280   303
topological domain   Extracellular   potential   17   279
topological domain   Cytoplasmic   potential   304   315
domain   Ig-like V-type      17   121
glycosylation site   N-linked (GlcNAc...)   potential   37   37
glycosylation site   N-linked (GlcNAc...)   potential   69   69
glycosylation site   N-linked (GlcNAc...)   potential   112   112
glycosylation site   N-linked (GlcNAc...)   potential   161   161
glycosylation site   N-linked (GlcNAc...)   potential   254   254
SP Length   16
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MARLPILLLLISLVYS
Sequence MARLPILLLLISLVYSTPSPQTSKKIGDDATLSCNRNNTNDYVVMSAWYK
EPNSIILLAAKSDVLYFD
NYTKDKISYDSPYDDLVTTITIKSLTARDAGT
YVCAFFMTSPT
NDTDKVDYEEYSTELIVNTDSESTIDIILSGSTHSPETS
SEKPEDIDNL
NCSSVFEIATPEPITDNVEDHTDTVTYTSDSINTVSASSG
ESTTDETPEPITDKEEDHTVTDTVSYTTVSTSSGIVTTKSTTDDADLYDT
YND
NDTVPSTTVGCSTTSISNYKTKDFVEIFGITALIILSAVAIFCITYY
IYN
KRSRKYKTENKV
Original MARLPILLLLISLVYSTPSPQTSKKIGDDATLSCNRNNTNDYVVMSAWYK
EPNSIILLAAKSDVLYFDNYTKDKISYDSPYDDLVTTITIKSLTARDAGT
YVCAFFMTSPTNDTDKVDYEEYSTELIVNTDSESTIDIILSGSTHSPETS
SEKPEDIDNLNCSSVFEIATPEPITDNVEDHTDTVTYTSDSINTVSASSG
ESTTDETPEPITDKEEDHTVTDTVSYTTVSTSSGIVTTKSTTDDADLYDT
YNDNDTVPSTTVGCSTTSISNYKTKDFVEIFGITALIILSAVAIFCITYY
IYNKRSRKYKTENKV
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11