Signal Peptide Database - Viruses

 Entry Details
ID   706
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q4QXJ7    (Created: 2006-05-30 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   POLS_EEEVF
Protein Name   Structural polyprotein
Gene  
Organism Scientific   Eastern equine encephalitis virus (strain Florida 91-469)
Organism Common   EEEV
Lineage   Viruses
  ssRNA positive-strand viruses, no DNA stage
    Togaviridae
      Alphavirus
        EEEV complex
Protein Length [aa]   1242
Protein Mass [Da]   137554
Features  
TypeDescriptionStatusStartEnd
signal peptide   Not cleaved   potential   262   282
chain   Capsid protein   by similarity   1   261
chain   p62   by similarity   262   744
chain   E3 protein   by similarity   262   324
chain   E2 envelope glycoprotein   by similarity   325   744
chain   6K protein   by similarity   745   801
chain   E1 envelope glycoprotein   by similarity   802   1242
disulfide bond      by similarity   850   915
disulfide bond      by similarity   863   895
disulfide bond      by similarity   864   897
disulfide bond      by similarity   869   879
disulfide bond      by similarity   1061   1073
disulfide bond      by similarity   1103   1178
disulfide bond      by similarity   1108   1182
disulfide bond      by similarity   1130   1172
transmembrane region      potential   689   709
transmembrane region      potential   760   780
transmembrane region      potential   781   801
transmembrane region      potential   1219   1239
topological domain   Extracellular   potential   325   688
topological domain   Cytoplasmic   potential   710   744
topological domain   Extracellular   potential   745   759
topological domain   Extracellular   potential   802   1218
topological domain   Cytoplasmic   potential   1240   1242
domain   Peptidase S3      105   261
region of interest   Intrinsically disordered, in contact with genomic RNA in nucleocapsid   potential   7   106
region of interest   Ribosome-binding   by similarity   87   99
region of interest   Transient transmembrane before p62-6K protein processing   potential   717   737
region of interest   E1 fusion peptide loop   by similarity   885   902
glycosylation site   N-linked (GlcNAc...)   potential   272   272
site   Cleavage; by capsid protein   by similarity   261   262
site   Cleavage; by host furin   by similarity   324   325
site   Cleavage; by host signal peptidase   by similarity   744   745
site   Cleavage; by host signal peptidase   by similarity   801   802
active site   Charge relay system   by similarity   138   138
active site   Charge relay system   by similarity   144   144
active site   Charge relay system   by similarity   212   212
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   717   717
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   737   737
lipid moiety-binding region   S-palmitoyl cysteine; by host   by similarity   738   738
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide SLATVMCVLANITFPCDQPPC
Sequence MFPYPTLNYPPMAPINPMAYRDPNPPRRRWRPFRPPLAAQIEDLRRSIAN
LTLKQRAPNPPAGPPAKRKKPAPKPKPAQAKKKRPP
PPAKKQKRKPKPGK
RQRMCM
KLESDKTFPIMLNGQVNGYACVVGGRVFKPLHVEGRIDNEQLAA
IKLKKASIYDLEYGDVPQCMKSDTLQYTSDKPPGFYNWHHGAVQYENNRF
TVPRGVGGKGD
SGRPILDNKGRVVAIVLGGVNEGSRTALSVVTWNQKGVT
VKDTPEGSEP
WSLATVMCVLANITFPCDQPPCMPCCYEKNPHETLTMLEQ
NYDSRAYDQLLDAAVKCNARRTR
RDLDTHFTQYKLARPYIADCPNCGHSR
CDSPIAIEEVRGDAHAGVIRIQTSAMFGLKTDGVDLAYMSFMNGKTQKSI
KIDNLHVRTSAPCSLVSHHGYYILAQCPPGDTVTVGFHDGPNRHTCTVAH
KVEFRPVGREKYRHPPEHGVELPCNRYTHKRADQGHYVEMHQPGLVADHS
LLSIHSAKVKITVPSGAQVKYYCKCPDVREGITSSDHTTTCTDVKQCRAY
LIDNKKWVYNSGRLPRGEGDTFKGKLHVPFVPVKAKCIATLAPEPLVEHK
HRTLILHLHPDHPTLLTTRSLGSDANPTRQWIERPTTVNFTVTGEGLEYT
WGNHPPKRVWAQESGEGNPHGWPHEVVVYYYNRYPLTT
IIGLCTCVAIIM
VSCVTSVWL
LCRTRNLCITPYKLAPNAQVPILLALLCCIKPTRADDTLQV
LNYLWNNNQ
NFFWMQTLIPLAALIVCMRMLRCLFCCGPAFLLVCGALGAA
AYEHTAVMPNKVGIPYKALVERPGYAPVHLQIQLVNTRIIPSTNLEYITC
KYKTKVPSPVVKCCGATQCTSKPHPDYQCQVFTG
VYPFMWGGAYCFCDTE
NT
QMSEAYVERSEECSIDHAKAYKVHTGTVQAMVNITYGSVSWRSADVYV
NGETPAKIGDAKLIIGPLSSAWSPFDNKVVVYGHEVYNYDFPEYGTGKAG
SFGDLQSRTSTSNDLYANTNLKLQRPQAGIVHTPFTQAPSGFERWKRDKG
APLNDVAPFGCSIALEPLRAENCAVGSIPISIDIPDAAFTRISETPTVSD
LECKITECTYASDFGGIATVAYKSSKAGNCPIHSPSGVAVIKENDVTLAE
SGSFTFHFSTANIHPAFKLQVCTSAVTCKGDCKPPKDHIVDYPAQHTESF
TSAISATAWSWLKVLVGG
TSAFIVLGLIATAVVALVLFFHRH
Original MFPYPTLNYPPMAPINPMAYRDPNPPRRRWRPFRPPLAAQIEDLRRSIAN
LTLKQRAPNPPAGPPAKRKKPAPKPKPAQAKKKRPPPPAKKQKRKPKPGK
RQRMCMKLESDKTFPIMLNGQVNGYACVVGGRVFKPLHVEGRIDNEQLAA
IKLKKASIYDLEYGDVPQCMKSDTLQYTSDKPPGFYNWHHGAVQYENNRF
TVPRGVGGKGDSGRPILDNKGRVVAIVLGGVNEGSRTALSVVTWNQKGVT
VKDTPEGSEPWSLATVMCVLANITFPCDQPPCMPCCYEKNPHETLTMLEQ
NYDSRAYDQLLDAAVKCNARRTRRDLDTHFTQYKLARPYIADCPNCGHSR
CDSPIAIEEVRGDAHAGVIRIQTSAMFGLKTDGVDLAYMSFMNGKTQKSI
KIDNLHVRTSAPCSLVSHHGYYILAQCPPGDTVTVGFHDGPNRHTCTVAH
KVEFRPVGREKYRHPPEHGVELPCNRYTHKRADQGHYVEMHQPGLVADHS
LLSIHSAKVKITVPSGAQVKYYCKCPDVREGITSSDHTTTCTDVKQCRAY
LIDNKKWVYNSGRLPRGEGDTFKGKLHVPFVPVKAKCIATLAPEPLVEHK
HRTLILHLHPDHPTLLTTRSLGSDANPTRQWIERPTTVNFTVTGEGLEYT
WGNHPPKRVWAQESGEGNPHGWPHEVVVYYYNRYPLTTIIGLCTCVAIIM
VSCVTSVWLLCRTRNLCITPYKLAPNAQVPILLALLCCIKPTRADDTLQV
LNYLWNNNQNFFWMQTLIPLAALIVCMRMLRCLFCCGPAFLLVCGALGAA
AYEHTAVMPNKVGIPYKALVERPGYAPVHLQIQLVNTRIIPSTNLEYITC
KYKTKVPSPVVKCCGATQCTSKPHPDYQCQVFTGVYPFMWGGAYCFCDTE
NTQMSEAYVERSEECSIDHAKAYKVHTGTVQAMVNITYGSVSWRSADVYV
NGETPAKIGDAKLIIGPLSSAWSPFDNKVVVYGHEVYNYDFPEYGTGKAG
SFGDLQSRTSTSNDLYANTNLKLQRPQAGIVHTPFTQAPSGFERWKRDKG
APLNDVAPFGCSIALEPLRAENCAVGSIPISIDIPDAAFTRISETPTVSD
LECKITECTYASDFGGIATVAYKSSKAGNCPIHSPSGVAVIKENDVTLAE
SGSFTFHFSTANIHPAFKLQVCTSAVTCKGDCKPPKDHIVDYPAQHTESF
TSAISATAWSWLKVLVGGTSAFIVLGLIATAVVALVLFFHRH
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11