Signal Peptide Database - Viruses

 Entry Details
ID   707
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q6X2U1    (Created: 2006-05-30 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   POLS_RUBVC
Protein Name   Structural polyprotein
Gene  
Organism Scientific   Rubella virus (strain BRDII)
Organism Common   RUBV
Lineage   Viruses
  ssRNA positive-strand viruses, no DNA stage
    Togaviridae
      Rubivirus
Protein Length [aa]   1063
Protein Mass [Da]   114763
Features  
TypeDescriptionStatusStartEnd
signal peptide   Not cleaved   potential   279   300
signal peptide   Not cleaved   potential   563   582
chain   Capsid protein      1   300
chain   E2 envelope glycoprotein      301   582
chain   E1 envelope glycoprotein      583   1063
disulfide bond      by similarity   590   595
disulfide bond      by similarity   619   824
disulfide bond      by similarity   641   653
disulfide bond      by similarity   699   712
disulfide bond      by similarity   758   767
disulfide bond      by similarity   807   817
disulfide bond      by similarity   931   934
disulfide bond      by similarity   950   983
transmembrane region      potential   535   555
transmembrane region      potential   1029   1049
topological domain   Extracellular   potential   301   534
topological domain   Cytoplasmic   potential   556   582
topological domain   Extracellular   potential   583   1028
topological domain   Extracellular   potential   1050   1063
region of interest   Human C1QBP/SF2P32-binding   by similarity   30   69
region of interest   Golgi retention signal   by similarity   535   555
region of interest   Endoplasmic reticulum retention signal   by similarity   1029   1050
modified residue   Phosphoserine; by host   by similarity   46   46
glycosylation site   N-linked (GlcNAc...)   potential   353   353
glycosylation site   N-linked (GlcNAc...)   potential   371   371
glycosylation site   N-linked (GlcNAc...)   potential   410   410
glycosylation site   N-linked (GlcNAc...)   potential   429   429
glycosylation site   N-linked (GlcNAc...)   potential   658   658
glycosylation site   N-linked (GlcNAc...)   potential   759   759
glycosylation site   N-linked (GlcNAc...)   potential   791   791
site   Cleavage; by host signal peptidase   potential   300   301
site   Cleavage; by host signal peptidase   potential   582   583
SP Length   22
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide GAPQVFLAGLLLAAVAVGTARA
Sequence MASTTPITMEDLQKALEAQSRALRAELAAGASQLRRPRPPRQRDSSTSGD
DSGRDSGGPRRRRGNRGRG
QRKDWSKAPPPPEERQESRSQTPVPKPPRAP
PQPPQPPRMQTGRGGTAPRPELGPPTNPFQAAVARGLRPPLHDPDTEAPT
EACVTSWLWSEGEGAVFYRVDLHFTNLGTRPLDEDGRWDPALMYNPCGPE
PPAHVVRAYNQPAGDVRGIWGKGERTYAEQDFRVGGTRWHRLLRMPVRGL
DGDSAPLPPHTTERIETRSARHPWRIRFGAPQVFLAGLLLAAVAVGTAR
A
G
LQPRTDIAAPPAPPQAPRAHGKHYGHHHHQLPFLGHDGHHGGTLRVGQH
HR
NASDVLPGHWLQGSWGCYNLSDWHQGTHVCHTKHMDFWCVEHDRPPPV
TPTPLTTAA
NSTTAATPATTPAPCHAGLNDSCGGFLSGCGPMRLRHGADT
RCGRLICGLSTTAQYPPTRFGCTMRWGLPPWELVVLTARPEDGWTCRGVP
AHPGTRCPELVSPMGHATCSPASALWLATANALS
LDHALAAVVLLVPWVL
IFMLC
RRACRRRGAAAALTAVVLQGYNPPAYGEEAFTYLCTAPGCATQTP
VPVRLAGVRFESKIVDGGCFAPWDLEATGACICEIPTDVSCEGLGAWVPA
APCARIW
NGTQRACTFWAVNAYSSGGYAQLASYFNPGGSYYKQYHPTACD
VEPAFGHSDAACWGFPTDTVMSVFALASYVQHPDKTVRVKFHTETRTVWQ
LSVAGVSC
NVTTEHPFCNTPHGQLEVQVPPDPGDLVEYIMNYTGNQQSRW
GLGSPNCHGPDWASPVCQRHSPDCSRLVGATPERPRLRLVDADDPLLRTA
PGPGEVWVTPVIGSQARKCGLHIRAGPYGHATVEMPEWIHAHTTSDPWHP
PGPLGLKFKTVRPVALPRALAPPRNVRVTGCYQCGTPALVEGLAPGGGNC
HLTVNGEDVGAFPPGKFVTAALLNTPPPYQVSCGGESDRASARVIDPAAQ
SFTGVVYGTHTTAVSETRQTWAEWAAAH
WWQLTLGAICALLLAGLLACCA
KCLYHLRGAIAPR
Original MASTTPITMEDLQKALEAQSRALRAELAAGASQLRRPRPPRQRDSSTSGD
DSGRDSGGPRRRRGNRGRGQRKDWSKAPPPPEERQESRSQTPVPKPPRAP
PQPPQPPRMQTGRGGTAPRPELGPPTNPFQAAVARGLRPPLHDPDTEAPT
EACVTSWLWSEGEGAVFYRVDLHFTNLGTRPLDEDGRWDPALMYNPCGPE
PPAHVVRAYNQPAGDVRGIWGKGERTYAEQDFRVGGTRWHRLLRMPVRGL
DGDSAPLPPHTTERIETRSARHPWRIRFGAPQVFLAGLLLAAVAVGTARA
GLQPRTDIAAPPAPPQAPRAHGKHYGHHHHQLPFLGHDGHHGGTLRVGQH
HRNASDVLPGHWLQGSWGCYNLSDWHQGTHVCHTKHMDFWCVEHDRPPPV
TPTPLTTAANSTTAATPATTPAPCHAGLNDSCGGFLSGCGPMRLRHGADT
RCGRLICGLSTTAQYPPTRFGCTMRWGLPPWELVVLTARPEDGWTCRGVP
AHPGTRCPELVSPMGHATCSPASALWLATANALSLDHALAAVVLLVPWVL
IFMLCRRACRRRGAAAALTAVVLQGYNPPAYGEEAFTYLCTAPGCATQTP
VPVRLAGVRFESKIVDGGCFAPWDLEATGACICEIPTDVSCEGLGAWVPA
APCARIWNGTQRACTFWAVNAYSSGGYAQLASYFNPGGSYYKQYHPTACD
VEPAFGHSDAACWGFPTDTVMSVFALASYVQHPDKTVRVKFHTETRTVWQ
LSVAGVSCNVTTEHPFCNTPHGQLEVQVPPDPGDLVEYIMNYTGNQQSRW
GLGSPNCHGPDWASPVCQRHSPDCSRLVGATPERPRLRLVDADDPLLRTA
PGPGEVWVTPVIGSQARKCGLHIRAGPYGHATVEMPEWIHAHTTSDPWHP
PGPLGLKFKTVRPVALPRALAPPRNVRVTGCYQCGTPALVEGLAPGGGNC
HLTVNGEDVGAFPPGKFVTAALLNTPPPYQVSCGGESDRASARVIDPAAQ
SFTGVVYGTHTTAVSETRQTWAEWAAAHWWQLTLGAICALLLAGLLACCA
KCLYHLRGAIAPR
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11