Signal Peptide Database - Viruses

 Entry Details
ID   805
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q8JSP8    (Created: 2007-04-17 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   SPIKE_CVPIA
Protein Name   Spike glycoprotein
Gene   S
Organism Scientific   Porcine hemagglutinating encephalomyelitis virus (strain IAF-404)
Organism Common   HEV
Lineage   Viruses
  ssRNA positive-strand viruses, no DNA stage
    Nidovirales
      Coronaviridae
        Coronavirus
          Coronavirus group 2
            Coronavirus group 2a
Protein Length [aa]   1349
Protein Mass [Da]   149649
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   17
chain   Spike glycoprotein   by similarity   18   1349
chain   Spike protein S1   by similarity   18   754
chain   Spike protein S2   by similarity   755   1349
transmembrane region      potential   1298   1314
topological domain   Extracellular   potential   18   1297
topological domain   Cytoplasmic   potential   1315   1349
region of interest   Heptad repeat 1   potential   1029   1072
region of interest   Heptad repeat 2   potential   1253   1283
glycosylation site   N-linked (GlcNAc...)   potential   59   59
glycosylation site   N-linked (GlcNAc...)   potential   133   133
glycosylation site   N-linked (GlcNAc...)   potential   198   198
glycosylation site   N-linked (GlcNAc...)   potential   437   437
glycosylation site   N-linked (GlcNAc...)   potential   456   456
glycosylation site   N-linked (GlcNAc...)   potential   635   635
glycosylation site   N-linked (GlcNAc...)   potential   662   662
glycosylation site   N-linked (GlcNAc...)   potential   682   682
glycosylation site   N-linked (GlcNAc...)   potential   700   700
glycosylation site   N-linked (GlcNAc...)   potential   725   725
glycosylation site   N-linked (GlcNAc...)   potential   774   774
glycosylation site   N-linked (GlcNAc...)   potential   923   923
glycosylation site   N-linked (GlcNAc...)   potential   1180   1180
glycosylation site   N-linked (GlcNAc...)   potential   1210   1210
glycosylation site   N-linked (GlcNAc...)   potential   1220   1220
glycosylation site   N-linked (GlcNAc...)   potential   1239   1239
glycosylation site   N-linked (GlcNAc...)   potential   1253   1253
glycosylation site   N-linked (GlcNAc...)   potential   1274   1274
site   Cleavage; by host   by similarity   754   755
compositionally biased region   Cys-rich      1315   1332
coiled-coil region      potential   1029   1073
coiled-coil region      potential   1255   1283
SP Length   17
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MFFILLITLPSVFAVIG
Sequence MFFILLITLPSVFAVIGDLKCNTSSINDVDTGVPSISSEVVDVTNGLGTF
YVLDRVYL
NTTLLLNGYYPISGATFRNVALKGTRLLSTLWFKPPFLSPFN
DGIFAKVKNSRFSKHGVIYSEFPAITIGSTFV
NTSYSIVVKPHTSFINGN
LQGFLQISVCQYTMCEYPQTICHPNLGNQRIELWHHDTDVVSCLYRR
NFT
YDVNADYLYFHFYQEGGTFYAYFTDTGFVTKFLFKLYLGTVLSHYYVMPL
TCDSALSLEYWVTPLTTRQFLLAFDQDGVLYHAVDCASDFMSEIMCKTSS
ITPPTGVYELNGYTVQPVATVYRRIPDLPNCDIEAWLNSKTVSSPLNWER
KIFSNCNFNMGRLMSFIQADSFGCNNIDASRLYGMCFGSITIDKFAIPNS
RKVDLQVGKSGYLQSFNYKIDTAVSSCQLYYSLPAA
NVSVTHYNPSSWNR
RYGFI
NQSFGSRGLHDAVYSQQCFNTPNTYCPCRTSQCIGGAGTGTCPVG
TTVRKCFAAVTNATKCTCWCQPDPSTYKGVNAWTCPQSKVSIQPGQHCPG
LGLVEDDCSGNPCTCKPQAFIGWSSETCLQNGRCNIFANFILNDVNSGTT
CSTDLQQGNTNITTDVCVNYDLYGITGQGILIEV
NATYYNSWQNLLYDSS
GNLYGFRDYLS
NRTFLIRSCYSGRVSAVFHANSSEPALMFRNLKCSHVFN
YTILRQIQLVNYFDSYLGCVVNAYNNTASAVSTCDLTVGSGYCVDYVTAL
RSR
RSFTTGYRFTNFEPFAANLVNDSIEPVGGLYEIQIPSEFTIGNLEEF
IQTSSPKVTIDCATFVCGDYAACRQQLAEYGSFCENINAILIEVNELLDT
TQLQVANSLMNGVTLSTKIKDGINFNVDDINFSSVLGCLGSECNRASTRS
AIEDLLFDKVKLSDVGFVQAYN
NCTGGAEIRDLICVQSYNGIKVLPPLLS
ENQISGYTSAATAASLFPPWTAAAGVPFYLNVQYRINGLGVTMDVLSQNQ
KLIASAFNNALDSIQEGFDATNSALVKI
QAVVNANAEALNNLLQQLSNRF
GAISASLQEILSRLDALEAKAQI
DRLINGRLTALNAYVSQQLSDSTLVKF
SAAQAIEKVNECVKSQSSRINFCGNGNHIISLVQNAPYGLYFIHFSYVPT
KYVTAKVSPGLCIAGDIGISPKSGYFINV
NNSWMFTGSGYYYPEPITQNN
VVVMSTCAV
NYTKAPDLMLNTSTPNLPDFKEELYQWFKNQSSLAPDLSFD
YI
NVTFLDLQDEMNRLQEAIKVLNHSYINLKDIGTYEYYVKWPWYVWLLI
CLAGVVMLVLLFFI
CCCTGCGTSCFKKCGGCFDDYTGHQEFVIKTSHDD
Original MFFILLITLPSVFAVIGDLKCNTSSINDVDTGVPSISSEVVDVTNGLGTF
YVLDRVYLNTTLLLNGYYPISGATFRNVALKGTRLLSTLWFKPPFLSPFN
DGIFAKVKNSRFSKHGVIYSEFPAITIGSTFVNTSYSIVVKPHTSFINGN
LQGFLQISVCQYTMCEYPQTICHPNLGNQRIELWHHDTDVVSCLYRRNFT
YDVNADYLYFHFYQEGGTFYAYFTDTGFVTKFLFKLYLGTVLSHYYVMPL
TCDSALSLEYWVTPLTTRQFLLAFDQDGVLYHAVDCASDFMSEIMCKTSS
ITPPTGVYELNGYTVQPVATVYRRIPDLPNCDIEAWLNSKTVSSPLNWER
KIFSNCNFNMGRLMSFIQADSFGCNNIDASRLYGMCFGSITIDKFAIPNS
RKVDLQVGKSGYLQSFNYKIDTAVSSCQLYYSLPAANVSVTHYNPSSWNR
RYGFINQSFGSRGLHDAVYSQQCFNTPNTYCPCRTSQCIGGAGTGTCPVG
TTVRKCFAAVTNATKCTCWCQPDPSTYKGVNAWTCPQSKVSIQPGQHCPG
LGLVEDDCSGNPCTCKPQAFIGWSSETCLQNGRCNIFANFILNDVNSGTT
CSTDLQQGNTNITTDVCVNYDLYGITGQGILIEVNATYYNSWQNLLYDSS
GNLYGFRDYLSNRTFLIRSCYSGRVSAVFHANSSEPALMFRNLKCSHVFN
YTILRQIQLVNYFDSYLGCVVNAYNNTASAVSTCDLTVGSGYCVDYVTAL
RSRRSFTTGYRFTNFEPFAANLVNDSIEPVGGLYEIQIPSEFTIGNLEEF
IQTSSPKVTIDCATFVCGDYAACRQQLAEYGSFCENINAILIEVNELLDT
TQLQVANSLMNGVTLSTKIKDGINFNVDDINFSSVLGCLGSECNRASTRS
AIEDLLFDKVKLSDVGFVQAYNNCTGGAEIRDLICVQSYNGIKVLPPLLS
ENQISGYTSAATAASLFPPWTAAAGVPFYLNVQYRINGLGVTMDVLSQNQ
KLIASAFNNALDSIQEGFDATNSALVKIQAVVNANAEALNNLLQQLSNRF
GAISASLQEILSRLDALEAKAQIDRLINGRLTALNAYVSQQLSDSTLVKF
SAAQAIEKVNECVKSQSSRINFCGNGNHIISLVQNAPYGLYFIHFSYVPT
KYVTAKVSPGLCIAGDIGISPKSGYFINVNNSWMFTGSGYYYPEPITQNN
VVVMSTCAVNYTKAPDLMLNTSTPNLPDFKEELYQWFKNQSSLAPDLSFD
YINVTFLDLQDEMNRLQEAIKVLNHSYINLKDIGTYEYYVKWPWYVWLLI
CLAGVVMLVLLFFICCCTGCGTSCFKKCGGCFDDYTGHQEFVIKTSHDD
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11