Signal Peptide Database - Viruses

 Entry Details
ID   898
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P16833    (Created: 1990-08-01 Updated: 2008-09-02)
UniProtKB/Swiss-Prot Entry Name   UL116_HCMVA
Protein Name   Uncharacterized protein UL116
Gene   UL116
Organism Scientific   Human cytomegalovirus (strain AD169)
Organism Common   HHV-5
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Herpesvirales
      Herpesviridae
        Betaherpesvirinae
          Cytomegalovirus
Protein Length [aa]   314
Protein Mass [Da]   34140
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   24
chain   Uncharacterized protein UL116      25   314
glycosylation site   N-linked (GlcNAc...)   potential   28   28
glycosylation site   N-linked (GlcNAc...)   potential   43   43
glycosylation site   N-linked (GlcNAc...)   potential   57   57
glycosylation site   N-linked (GlcNAc...)   potential   77   77
glycosylation site   N-linked (GlcNAc...)   potential   101   101
glycosylation site   N-linked (GlcNAc...)   potential   102   102
glycosylation site   N-linked (GlcNAc...)   potential   109   109
glycosylation site   N-linked (GlcNAc...)   potential   151   151
glycosylation site   N-linked (GlcNAc...)   potential   170   170
glycosylation site   N-linked (GlcNAc...)   potential   217   217
glycosylation site   N-linked (GlcNAc...)   potential   223   223
glycosylation site   N-linked (GlcNAc...)   potential   252   252
glycosylation site   N-linked (GlcNAc...)   potential   255   255
glycosylation site   N-linked (GlcNAc...)   potential   268   268
SP Length   24
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKRRRRWRGWLLFPALCFCLLCEA
Sequence MKRRRRWRGWLLFPALCFCLLCEAVETNATTVTSTTAAAATTNTTVATTG
TTTTSP
NVTSTTSNTVTTPTTVSSVSNLTSSTTSIPISTSTVSGTRNTGN
NNTTTIGTNATSPSPSVSILTTVTPAATSTISVDGVVTASDYTPTFDDLE
NITTTRAPTRPPAQDLCSHNLSIILYEEESQSSVDIAVDEEEPELEDDDE
YDELWFPLYFEAECNR
NYTLHVNHSCDYSVRQSSVSFPPWRDIDSVTFVP
R
NLSNCSAHGLAVIVAGNQTWYVNPFSLAHLLDAIYNVLGIEDLSANFRR
QLAPYRHTLIVPQT
Original MKRRRRWRGWLLFPALCFCLLCEAVETNATTVTSTTAAAATTNTTVATTG
TTTTSPNVTSTTSNTVTTPTTVSSVSNLTSSTTSIPISTSTVSGTRNTGN
NNTTTIGTNATSPSPSVSILTTVTPAATSTISVDGVVTASDYTPTFDDLE
NITTTRAPTRPPAQDLCSHNLSIILYEEESQSSVDIAVDEEEPELEDDDE
YDELWFPLYFEAECNRNYTLHVNHSCDYSVRQSSVSFPPWRDIDSVTFVP
RNLSNCSAHGLAVIVAGNQTWYVNPFSLAHLLDAIYNVLGIEDLSANFRR
QLAPYRHTLIVPQT
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11