Signal Peptide Database - Viruses

 Entry Details
ID   899
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q6RJQ3    (Created: 2006-10-31 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   UL141_HCMVM
Protein Name   Protein UL141
Gene   UL141
Organism Scientific   Human cytomegalovirus (strain Merlin)
Organism Common   HHV-5
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Herpesvirales
      Herpesviridae
        Betaherpesvirinae
          Cytomegalovirus
Protein Length [aa]   338
Protein Mass [Da]   38918
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   36
chain   Protein UL141      37   338
transmembrane region      potential   279   299
topological domain   Extracellular   potential   37   278
topological domain   Cytoplasmic   potential   300   338
glycosylation site   N-linked (GlcNAc...)   potential   117   117
glycosylation site   N-linked (GlcNAc...)   potential   132   132
glycosylation site   N-linked (GlcNAc...)   potential   147   147
sequence variant   (in strain: Isolate 13J, Isolate 51C)      0   0
sequence variant         0   0
sequence variant   (in strain: Isolate 2J, Isolate 10J, Isolate 25J, Isolate 29C, Isolate 27C, Isolate 39J, Isolate 18M, Isolate 33J, Isolate 14)      0   0
sequence variant   (in strain: Isolate 2J, Isolate 10J, Isolate 25J, Isolate 39J, Isolate 45J, Isolate 29C, Isolate 27C, Isolate 18M, Isolate 33, Isolate 14)      0   0
sequence variant   (in strain: Isolate 10J)      0   0
sequence variant   (in strain: Isolate 2J, Isolate 10J, Isolate 29C, Isolate 27C, Isolate 18M, Isolate 33J, Isolate 45J, Isolate 14)      0   0
sequence variant   (in strain: Isolate 45J)      0   0
sequence variant   (in strain: Isolate 8J, Isolate 16m)      0   0
sequence variant   (in strain: Isolate 84)      0   0
sequence variant   (in strain: Isolate 8J, Isolate 16m, Isolate 63J)      0   0
sequence variant   (in strain: Isolate 10J, Isolate 2J, Isolate 29C, Isolate 27C, Isolate 18M, Isolate 33J, Isolate 14, Isolate 32C, Isolate 39J, Isolate 63J)      0   0
sequence variant   (in strain: Isolate 1M, Isolate 10J, Isolate 2J, Isolate 29C, Isolate 27C, Isolate 18M, Isolate 33J, Isolate 14, Isolate 32C, Isolate 39J, Isolate 63J, Isolate 25J, Isolate 9J)      0   0
sequence variant   (in strain: Isolate 45J)      0   0
sequence variant   (in strain: Isolate 1M)      0   0
sequence variant   (in strain: Isolate 2J, Isolate 10J, Isolate 45J, Isolate 29C, Isolate 27C, Isolate 18M, Isolate 33J, Isolate 14)      0   0
SP Length   36
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MCRRESLRTLPWLFWVLLSCPRLLEYSSSSFPFATA
Sequence MCRRESLRTLPWLFWVLLSCPRLLEYSSSSFPFATADIAEKMWAENYETT
SPAPVLVAEGEQVTIPCTVMTHSWPMVSIRARFCRSHDGSDELILDAVKG
HRLMNGLQYRLPYATW
NFSQLHLGQIFSLTFNVSTDTAGMYECVLRNYSH
GLIMQRFVILTQLETLSRPDEPCCTPALGRYSLGDQIWSPTPWRLRNHDC
GMYRGFQRNYFYIGRADAEDCWKPACPDEEPDRCWTVIQRYRLPGDCYRS
QPHPPKFLPVTPAPPADIDTGMSPWATR
GIAAFLGFWSIFTVCFLCYLCY
LQCCGRWCPTPGRGRRGGEGYRRLPTYDSYPGVKKMKR
Original MCRRESLRTLPWLFWVLLSCPRLLEYSSSSFPFATADIAEKMWAENYETT
SPAPVLVAEGEQVTIPCTVMTHSWPMVSIRARFCRSHDGSDELILDAVKG
HRLMNGLQYRLPYATWNFSQLHLGQIFSLTFNVSTDTAGMYECVLRNYSH
GLIMQRFVILTQLETLSRPDEPCCTPALGRYSLGDQIWSPTPWRLRNHDC
GMYRGFQRNYFYIGRADAEDCWKPACPDEEPDRCWTVIQRYRLPGDCYRS
QPHPPKFLPVTPAPPADIDTGMSPWATRGIAAFLGFWSIFTVCFLCYLCY
LQCCGRWCPTPGRGRRGGEGYRRLPTYDSYPGVKKMKR
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11