Signal Peptide Database - Viruses

 Entry Details
ID   903
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P09731    (Created: 1989-07-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   US07_HCMVA
Protein Name   Unique short US7 glycoprotein
Gene   US7
Organism Scientific   Human cytomegalovirus (strain AD169)
Organism Common   HHV-5
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Herpesvirales
      Herpesviridae
        Betaherpesvirinae
          Cytomegalovirus
Protein Length [aa]   225
Protein Mass [Da]   26270
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   17
chain   Unique short US7 glycoprotein      18   225
disulfide bond      by similarity   63   141
transmembrane region      potential   171   191
topological domain   Lumenal   potential   18   170
topological domain   Cytoplasmic   potential   192   225
domain   Ig-like H-type      54   145
glycosylation site   N-linked (GlcNAc...)   potential   69   69
SP Length   17
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MRIQLLLVATLVASIVA
Sequence MRIQLLLVATLVASIVATRVEDMATFRTEKQWQQDLQYRREFVKRQLAPK
PKS
NIVVSHTVSCVIDGGNMTSVWRFEGQFNPHIASEVILHDTSGLYNVP
HEIQNDGQVLTVTVKRSAPADIAKVLISLKPVQLSSGQYECRPQL
QLPWV
PRPSSFMYDSYRLWYEKRWL
TIILYVFMWTYLVTLLQYCIVRFIGTRLFY
FLQRNITIRFTGKPTYNLLTYPVKG
Original MRIQLLLVATLVASIVATRVEDMATFRTEKQWQQDLQYRREFVKRQLAPK
PKSNIVVSHTVSCVIDGGNMTSVWRFEGQFNPHIASEVILHDTSGLYNVP
HEIQNDGQVLTVTVKRSAPADIAKVLISLKPVQLSSGQYECRPQLQLPWV
PRPSSFMYDSYRLWYEKRWLTIILYVFMWTYLVTLLQYCIVRFIGTRLFY
FLQRNITIRFTGKPTYNLLTYPVKG
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11