Signal Peptide Database - Viruses

 Entry Details
ID   907
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P26707    (Created: 1992-08-01 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   V124_ASFL5
Protein Name   Protein LIS 124-1
Gene   LIS124-1
Organism Scientific   African swine fever virus (isolate Portugal/Lis 57/1957)
Organism Common   ASFV
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Asfarviridae
      Asfivirus
Protein Length [aa]   124
Protein Mass [Da]   14452
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   18
chain   Protein LIS 124-1      19   124
compositionally biased region   Cys-rich      42   102
SP Length   18
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLVIFLGILGLLANQVLG
Sequence MLVIFLGILGLLANQVLGLPTQAEGHLRSTDNPPQEELGYWCTYMESCKF
CWECEHGICKNKVNRSMPWIIENSYLTSCEVSRWYNQCTYDEGNGHYHVM
DC
SNPVPHNRPHRLGRKIYEKEDL
Original MLVIFLGILGLLANQVLGLPTQAEGHLRSTDNPPQEELGYWCTYMESCKF
CWECEHGICKNKVNRSMPWIIENSYLTSCEVSRWYNQCTYDEGNGHYHVM
DCSNPVPHNRPHRLGRKIYEKEDL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11