Signal Peptide Database - Viruses

 Entry Details
ID   908
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P19347    (Created: 1990-11-01 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   VA1_BPBF2
Protein Name   Probable protein A1
Gene   A1
Organism Scientific   Enterobacteria phage BF23
Organism Common   Bacteriophage BF23
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Caudovirales
      Siphoviridae
        T5-like viruses
          unclassified T5-like viruses
Protein Length [aa]   37
Protein Mass [Da]   4431
Features  
TypeDescriptionStatusStartEnd
signal peptide      probable   1   22
chain   Probable protein A1      23   37
non-terminal residue         37   37
SP Length   22
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MIFYPTESLILGLFIMAASLLF
Sequence MIFYPTESLILGLFIMAASLLFAYFQNDLDSYYFKRK
Original MIFYPTESLILGLFIMAASLLFAYFQNDLDSYYFKRK
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11