Signal Peptide Database - Viruses

 Entry Details
ID   912
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P21014    (Created: 1991-02-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   VF05_VACCC
Protein Name   36 kDa major membrane protein
Gene   F5L
Organism Scientific   Vaccinia virus (strain Copenhagen)
Organism Common   VACV
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Poxviridae
      Chordopoxvirinae
        Orthopoxvirus
Protein Length [aa]   321
Protein Mass [Da]   36479
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   20
chain   36 kDa major membrane protein      21   321
transmembrane region      potential   286   306
glycosylation site   N-linked (GlcNAc...)   potential   41   41
glycosylation site   N-linked (GlcNAc...)   potential   72   72
glycosylation site   N-linked (GlcNAc...)   potential   79   79
glycosylation site   N-linked (GlcNAc...)   potential   108   108
glycosylation site   N-linked (GlcNAc...)   potential   144   144
glycosylation site   N-linked (GlcNAc...)   potential   220   220
glycosylation site   N-linked (GlcNAc...)   potential   245   245
SP Length   20
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MGTNVVRVFVILYLLAVCGC
Sequence MGTNVVRVFVILYLLAVCGCIEYDVDDNVHICTHTDVSHINHTSWYYNDK
VIALATEDKTSGYISSFIKRV
NISLTCLNISSLRYEDSGTYKGVSHLKDG
VIVTTTM
NISVKANIIDLTGRVRYLTRNYCEVKIRCEITSFALNGSTTPP
HMILGTVDKWKYLPFPTDDYRYVGELKRYISGNPYPTESLALEISSTFNR
FTIVKNLNDDEFSCYLFSQ
NYSFHKMLNARHICESEWKALNNNDNASSMP
ASHNNLANDLSSMMSQLQNDNDDNNDYSAPMNVDN
LIMIVLITMLSIILV
IIVVIA
AISMYKKSKYRHIDN
Original MGTNVVRVFVILYLLAVCGCIEYDVDDNVHICTHTDVSHINHTSWYYNDK
VIALATEDKTSGYISSFIKRVNISLTCLNISSLRYEDSGTYKGVSHLKDG
VIVTTTMNISVKANIIDLTGRVRYLTRNYCEVKIRCEITSFALNGSTTPP
HMILGTVDKWKYLPFPTDDYRYVGELKRYISGNPYPTESLALEISSTFNR
FTIVKNLNDDEFSCYLFSQNYSFHKMLNARHICESEWKALNNNDNASSMP
ASHNNLANDLSSMMSQLQNDNDDNNDYSAPMNVDNLIMIVLITMLSIILV
IIVVIAAISMYKKSKYRHIDN
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11