Signal Peptide Database - Viruses

 Entry Details
ID   914
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q69024    (Created: 1998-12-15 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   VGLB_GPCMV
Protein Name   Glycoprotein B
Gene   GB
Organism Scientific   Guinea pig cytomegalovirus (strain 22122 / ATCC VR682)
Organism Common   GPCMV
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Herpesvirales
      Herpesviridae
        Betaherpesvirinae
Protein Length [aa]   901
Protein Mass [Da]   102240
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   34
chain   Glycoprotein B      35   901
transmembrane region      potential   714   734
transmembrane region      potential   737   757
topological domain   Extracellular   potential   35   713
topological domain   Cytoplasmic   potential   758   901
glycosylation site   N-linked (GlcNAc...)   potential   53   53
glycosylation site   N-linked (GlcNAc...)   potential   60   60
glycosylation site   N-linked (GlcNAc...)   potential   66   66
glycosylation site   N-linked (GlcNAc...)   potential   197   197
glycosylation site   N-linked (GlcNAc...)   potential   270   270
glycosylation site   N-linked (GlcNAc...)   potential   289   289
glycosylation site   N-linked (GlcNAc...)   potential   328   328
glycosylation site   N-linked (GlcNAc...)   potential   372   372
glycosylation site   N-linked (GlcNAc...)   potential   398   398
glycosylation site   N-linked (GlcNAc...)   potential   406   406
glycosylation site   N-linked (GlcNAc...)   potential   436   436
glycosylation site   N-linked (GlcNAc...)   potential   537   537
glycosylation site   N-linked (GlcNAc...)   potential   571   571
glycosylation site   N-linked (GlcNAc...)   potential   623   623
SP Length   34
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MRPVRGIARSRILSCSWRGTWTSALTILYLGVYC
Sequence MRPVRGIARSRILSCSWRGTWTSALTILYLGVYCESTTVTPTTVEDTTVS
NG
NHSDASRNNTVIRNLTASVDFSQRKLYPYRICSMSMGTDLVRFARTIQ
CVPFNPRVNSEEGIMLIYKRNILPYVFTAYTYQKELLFQRSYKYVTYDYL
LGYSREFVALPMWEIFLVNSRGQCYTSHQRVIGADRYIAYHNDNEV
NETM
WLMRDDMGNDDTYRYITVKEHARTPGSVWLYKETCSMNCIVTKTKGKSKF
PYDMFVLPSGVIVNISPFY
NGSNGKTFREQREKFHIWSNYSILKDFGSRA
LEARIVPKMAFYEREDVVIGWEVNDQS
NVTCEMILWETVDRAIRTEYENA
FHYVARTLTSTFVENKYSPDN
NLTEDDIKCFKNDAQKKIEEVFLRDYNET
YDMDG
NATYHVTTGGLVIVWQGLKQKSLKALEIAANESAVSATGSNSRRK
RSLPDESTGDISYAQLQFAYDTLRTYINQALGHIAEAWCLDQKRTAEVLH
ELSKINPSNILSAIFGVPVAARVVGDVISLAKCIEV
NQSTVLIKGDMRKF
SDDGKLEGCYSRPVVWFSMK
NSTEVRLGQLGEDNEILLGTHRMETCQTQD
YRIFVAGDIGYEFQQYVFTKKI
NLSEIDIIDTMIALKTEPLENIDFKVLE
LYSRDELAQANVFDLESIMREYNYQKKRLDFVVERVINPIPPALKGLDEM
MNGMGAIGKGIGE
AVGAVGGAIGSFIGALVTFVTNPFGAFVVFLFCVGCI
TLVITVY
RRQRRAMQRPFDYFFPYASQTITSSVADSSIAVAYPGPEGTSG
DAPPPYPGEAPYGYKDLSVDADTRVSSSSAGAGADFNEEDAVRMLRAIKR
LDDKKRQEIEKSSKDSASNKNSETRRRPGIMDRLRRRGGYQKLNTEDDVH
V
Original MRPVRGIARSRILSCSWRGTWTSALTILYLGVYCESTTVTPTTVEDTTVS
NGNHSDASRNNTVIRNLTASVDFSQRKLYPYRICSMSMGTDLVRFARTIQ
CVPFNPRVNSEEGIMLIYKRNILPYVFTAYTYQKELLFQRSYKYVTYDYL
LGYSREFVALPMWEIFLVNSRGQCYTSHQRVIGADRYIAYHNDNEVNETM
WLMRDDMGNDDTYRYITVKEHARTPGSVWLYKETCSMNCIVTKTKGKSKF
PYDMFVLPSGVIVNISPFYNGSNGKTFREQREKFHIWSNYSILKDFGSRA
LEARIVPKMAFYEREDVVIGWEVNDQSNVTCEMILWETVDRAIRTEYENA
FHYVARTLTSTFVENKYSPDNNLTEDDIKCFKNDAQKKIEEVFLRDYNET
YDMDGNATYHVTTGGLVIVWQGLKQKSLKALEIAANESAVSATGSNSRRK
RSLPDESTGDISYAQLQFAYDTLRTYINQALGHIAEAWCLDQKRTAEVLH
ELSKINPSNILSAIFGVPVAARVVGDVISLAKCIEVNQSTVLIKGDMRKF
SDDGKLEGCYSRPVVWFSMKNSTEVRLGQLGEDNEILLGTHRMETCQTQD
YRIFVAGDIGYEFQQYVFTKKINLSEIDIIDTMIALKTEPLENIDFKVLE
LYSRDELAQANVFDLESIMREYNYQKKRLDFVVERVINPIPPALKGLDEM
MNGMGAIGKGIGEAVGAVGGAIGSFIGALVTFVTNPFGAFVVFLFCVGCI
TLVITVYRRQRRAMQRPFDYFFPYASQTITSSVADSSIAVAYPGPEGTSG
DAPPPYPGEAPYGYKDLSVDADTRVSSSSAGAGADFNEEDAVRMLRAIKR
LDDKKRQEIEKSSKDSASNKNSETRRRPGIMDRLRRRGGYQKLNTEDDVH
V
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11