Signal Peptide Database - Viruses

 Entry Details
ID   915
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P10681    (Created: 1990-01-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   VGLC_GAHVG
Protein Name   Secretory glycoprotein GP57-65
Gene   GA
Organism Scientific   Gallid herpesvirus 2 (strain GA)
Organism Common   GaHV-2
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Herpesvirales
      Herpesviridae
        Alphaherpesvirinae
          Mardivirus
Protein Length [aa]   505
Protein Mass [Da]   56809
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   27
chain   Secretory glycoprotein GP57-65      28   505
transmembrane region   Membrane anchor   potential   465   491
domain   Ig-like      257   355
glycosylation site   N-linked (GlcNAc...)   potential   45   45
glycosylation site   N-linked (GlcNAc...)   potential   90   90
glycosylation site   N-linked (GlcNAc...)   potential   99   99
glycosylation site   N-linked (GlcNAc...)   potential   119   119
glycosylation site   N-linked (GlcNAc...)   potential   211   211
glycosylation site   N-linked (GlcNAc...)   potential   353   353
glycosylation site   N-linked (GlcNAc...)   potential   399   399
glycosylation site   N-linked (GlcNAc...)   potential   428   428
SP Length   27
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLTPRVLRALGWTGLFFLLLSPSNVLG
Sequence MLTPRVLRALGWTGLFFLLLSPSNVLGASLSRDLEHPILSFDPSNISING
APLTEVPHAPSTESVSTNSESTNEHTITETTGKNAYIHN
NASTDKQNAND
THKTPNILCDTEEVFVFL
NETGRFVCTLKVDPPSDSEWSNFVLDLIFNPI
EYHANEKNVEAARIAGLYGVPGSDYAYPRQSELISSIRRDPQGTFWTSPS
PHGNKYFIWI
NKTTNTMGVEIRNVDYADNGYMQVIMRDHFNRPLIDKHIY
IRVCQR
PASVDVLAPPVLSGENYKASCIVRHFYPPGSVYVSWRQNGNIAT
PRKDRDGSFWWFESGRGATLVSTITLGNSGIDFPPKISCLVAWKQGDMIS
TT
NATAIPTVYHHPRLSLAFKDGYAICTIECVPSEITVRWLVHDEAQPNT
TYNTVVTGLCRTIDRHRNLLSRIPVWD
NWTKTKYTCRLIGYPFDEDKFQD
SEYYDATPSARGTP
MVITVNGSFGIGCNFRVGDNHDCPMFIHSTRKIFDY
NLIVM
Original MLTPRVLRALGWTGLFFLLLSPSNVLGASLSRDLEHPILSFDPSNISING
APLTEVPHAPSTESVSTNSESTNEHTITETTGKNAYIHNNASTDKQNAND
THKTPNILCDTEEVFVFLNETGRFVCTLKVDPPSDSEWSNFVLDLIFNPI
EYHANEKNVEAARIAGLYGVPGSDYAYPRQSELISSIRRDPQGTFWTSPS
PHGNKYFIWINKTTNTMGVEIRNVDYADNGYMQVIMRDHFNRPLIDKHIY
IRVCQRPASVDVLAPPVLSGENYKASCIVRHFYPPGSVYVSWRQNGNIAT
PRKDRDGSFWWFESGRGATLVSTITLGNSGIDFPPKISCLVAWKQGDMIS
TTNATAIPTVYHHPRLSLAFKDGYAICTIECVPSEITVRWLVHDEAQPNT
TYNTVVTGLCRTIDRHRNLLSRIPVWDNWTKTKYTCRLIGYPFDEDKFQD
SEYYDATPSARGTPMVITVNGSFGIGCNFRVGDNHDCPMFIHSTRKIFDY
NLIVM
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11