Signal Peptide Database - Viruses

 Entry Details
ID   916
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q6S6V7    (Created: 2004-11-09 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   VGLE_EHV1B
Protein Name   Glycoprotein E
Gene   GE
Organism Scientific   Equine herpesvirus 1 (strain Ab4p)
Organism Common   EHV-1
Lineage   Viruses
  dsDNA viruses, no RNA stage
    Herpesvirales
      Herpesviridae
        Alphaherpesvirinae
          Varicellovirus
Protein Length [aa]   550
Protein Mass [Da]   61183
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   23
chain   Glycoprotein E      24   550
transmembrane region      potential   409   425
glycosylation site   N-linked (GlcNAc...)   potential   47   47
glycosylation site   N-linked (GlcNAc...)   potential   109   109
glycosylation site   N-linked (GlcNAc...)   potential   122   122
glycosylation site   N-linked (GlcNAc...)   potential   241   241
glycosylation site   N-linked (GlcNAc...)   potential   291   291
SP Length   23
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MELLAASRACIFFGLVTVLDAWG
Sequence MELLAASRACIFFGLVTVLDAWGVQQVELSEGAWAMIDGRDVLTPTNTTT
RVTKAWTFLETPPGCAGDISVKKVCVSHSLCEDNIIIGKHCNLLTGEHGI
ALAEFNVV
NGSLRRTDDVYFVNGTVFPILAETRSVLQIHRATPSIAGVYT
LHVSIDGMMKHSVVLLTVKKPPKQPQPRLRVKTPPPVTVPQVPVKTHTDF
VVHGYHSRVYADGESFELSVNLESHIVEPSFSAEIQWYYM
NTSSSSCDLF
RVFETCIFHPTAMACLHPEQHTCSFTSPIRATKILHRVYG
NCSDHGNSWP
SRCHSTLLGNRLYFIQPAQNRVDLLFKDTPASATGLYVFVLLYNGHPEAW
TYTLLSTANHFMNVLTDVTRPRLGEHFYTDLGHKIITPHPSVATTEELGA
WTRHYLAF
LLVIICTCAALLVALVVWGCILYIRSNRKPYEVLNPFETVYT
SVPSNDPSDEVLVFERLASDSDDSFDSDSDEELEYPPPPKPAPQLPPYQF
VDGGDAPSGRSGFKVWFRDTPEASPVPLHKPTLQGPDYSRVASKLKSILK
Original MELLAASRACIFFGLVTVLDAWGVQQVELSEGAWAMIDGRDVLTPTNTTT
RVTKAWTFLETPPGCAGDISVKKVCVSHSLCEDNIIIGKHCNLLTGEHGI
ALAEFNVVNGSLRRTDDVYFVNGTVFPILAETRSVLQIHRATPSIAGVYT
LHVSIDGMMKHSVVLLTVKKPPKQPQPRLRVKTPPPVTVPQVPVKTHTDF
VVHGYHSRVYADGESFELSVNLESHIVEPSFSAEIQWYYMNTSSSSCDLF
RVFETCIFHPTAMACLHPEQHTCSFTSPIRATKILHRVYGNCSDHGNSWP
SRCHSTLLGNRLYFIQPAQNRVDLLFKDTPASATGLYVFVLLYNGHPEAW
TYTLLSTANHFMNVLTDVTRPRLGEHFYTDLGHKIITPHPSVATTEELGA
WTRHYLAFLLVIICTCAALLVALVVWGCILYIRSNRKPYEVLNPFETVYT
SVPSNDPSDEVLVFERLASDSDDSFDSDSDEELEYPPPPKPAPQLPPYQF
VDGGDAPSGRSGFKVWFRDTPEASPVPLHKPTLQGPDYSRVASKLKSILK
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11